Overview

  • Product name

    Anti-UBE2E3 antibody [OTI4B4]
    See all UBE2E3 primary antibodies
  • Description

    Mouse monoclonal [OTI4B4] to UBE2E3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human UBE2E3 aa 1-207. (NP_006348) produced in E.coli.
    Sequence:

    MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTK LSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGP PGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILK DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQ WTKRYAT


    Database link: Q969T4

  • Positive control

    • WB: HepG2 extracts; HEK-293T cells transiently transfected with the UBE2E3 cDNA. IHC-P: Human endometrium adenocarcinoma tissue. ICC/IF: HepG2 cells. FC: HeLa and Jurkat cells; HEK-293T cells transfected with UBE2E3 overexpressing plasmid.
  • General notes

    Clone OTI4B4 (formerly 4B4).

Properties

Applications

Our Abpromise guarantee covers the use of ab128098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 22 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
Flow Cyt 1/100.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

ICC/IF 1/100.

Target

  • Function

    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest.
  • Tissue specificity

    Ubiquitously expressed at low levels. Highly expressed in skeletal muscle.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization

    Nucleus. Cytoplasm. Shuttles between the nucleus and cytoplasm in a IPO11-dependent manner.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homologous to yeast UBC4/5 antibody
    • UB2E3_HUMAN antibody
    • UBC E4 antibody
    • Ubc M2 antibody
    • UBC4/5 homolog antibody
    • UBCE 4 antibody
    • UBCE4 antibody
    • UBCH 9 antibody
    • UbcH9 antibody
    • UbcM2 antibody
    • UBE2 E3 antibody
    • UBE2E3 antibody
    • Ubiquitin carrier protein antibody
    • Ubiquitin carrier protein E3 antibody
    • Ubiquitin conjugating enzyme E2 23 kDa antibody
    • Ubiquitin conjugating enzyme E2 E3 antibody
    • Ubiquitin conjugating enzyme E2E 3 (homologous to yeast UBC4/5) antibody
    • Ubiquitin conjugating enzyme E2E 3 (UBC4/5 homolog, yeast antibody
    • Ubiquitin conjugating enzyme E2E 3 antibody
    • Ubiquitin conjugating enzyme UBCH 9 antibody
    • Ubiquitin conjugating enzyme UBCH9 antibody
    • Ubiquitin protein ligase antibody
    • Ubiquitin protein ligase E3 antibody
    • Ubiquitin-conjugating enzyme E2 E3 antibody
    • Ubiquitin-conjugating enzyme E2-23 kDa antibody
    • Ubiquitin-protein ligase E3 antibody
    see all

Images

  • Anti-UBE2E3 antibody [OTI4B4] (ab128098) at 1/200 dilution + HepG2 (Human liver hepatocellular carcinoma cell line) extracts at 10 µg

    Predicted band size: 22 kDa

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for UBE2E3 with ab128098 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for UBE2E3 using ab128098 at a 1/100 dilution in ICC/IF.

  • Flow cytometry analysis of HeLa (Human epithelial cell line from cervix adenocarcinoma) cells, using anti-UBE2E3 antibody (ab128098) in Red at 1/100 dilution, compared to a nonspecific negative control antibody in Blue.

  • Flow cytometry analysis of Jurkat (Human T cell leukemia cell line from peripheral blood) cells, using anti-UBE2E3 antibody (ab128098) in Red at 1/100 dilution, compared to a nonspecific negative control antibody in Blue.

  • Flow cytometry analysis of HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either UBE2E3 overexpressing plasmid (Red) or empty vector control plasmid (Blue) and immunostained by anti-UBE2E3 antibody (ab128098) at 1/100 dilution.

  • All lanes : Anti-UBE2E3 antibody [OTI4B4] (ab128098) at 1/2000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells were transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cells were transfected with pCMV6-ENTRY UBE2E3 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 22 kDa

References

ab128098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab128098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up