Overview

  • Product name

    Anti-UBE2I / UBC9 antibody
    See all UBE2I / UBC9 primary antibodies
  • Description

    Rabbit polyclonal to UBE2I / UBC9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Chicken, Zebrafish
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human UBE2I/ UBC9 aa 33-158. (Expressed in E.coli).
    Sequence:

    DGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLF HPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAE AYTIYCQNRVEYEKRVRAQAKKFAPS


    Database link: P63279

  • Positive control

    • WB: Recombinant human UBE2I / UBC9 protein; Human lung lysate; HeLa cell lysate; Pig spleen and uterus lysates. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 18 kDa.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Accepts the ubiquitin-like proteins SUMO1, SUMO2, SUMO3 and SUMO4 from the UBLE1A-UBLE1B E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as RANBP2 or CBX4. Necessary for sumoylation of FOXL2 and KAT5. Essential for nuclear architecture and chromosome segregation.
  • Tissue specificity

    Expressed in heart, skeletal muscle, pancreas, kidney, liver, lung, placenta and brain. Also expressed in testis and thymus.
  • Pathway

    Protein modification; protein sumoylation.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization

    Nucleus. Cytoplasm. Mainly nuclear. In spermatocytes, localizes in synaptonemal complexes. Recruited by BCL11A into the nuclear body.
  • Information by UniProt
  • Database links

  • Alternative names

    • C358B7.1 antibody
    • p18 antibody
    • SUMO 1 protein ligase antibody
    • SUMO conjugating enzyme UBC9 antibody
    • SUMO-conjugating enzyme UBC9 antibody
    • SUMO-protein ligase antibody
    • SUMO1 protein ligase antibody
    • UBC9 antibody
    • UBC9_HUMAN antibody
    • UBCE9 antibody
    • Ube2i antibody
    • Ubiquitin carrier protein 9 antibody
    • Ubiquitin carrier protein antibody
    • Ubiquitin carrier protein I antibody
    • Ubiquitin conjugating enzyme 9 antibody
    • Ubiquitin conjugating enzyme E2I (homologous to yeast UBC9) antibody
    • Ubiquitin conjugating enzyme E2I (UBC9 homolog, yeast) antibody
    • Ubiquitin conjugating enzyme UbcE2A antibody
    • Ubiquitin like protein SUMO 1 conjugating enzyme antibody
    • Ubiquitin protein ligase E2I antibody
    • Ubiquitin-conjugating enzyme E2 I antibody
    • Ubiquitin-protein ligase I antibody
    see all

Images

  • Anti-UBE2I / UBC9 antibody (ab233224) at 2 µg + Recombinant human UBE2I / UBC9 protein

    Predicted band size: 18 kDa

  • All lanes : Anti-UBE2I / UBC9 antibody (ab233224) at 2 µg/ml

    Lane 1 : Human lung lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : Pig spleen lysate
    Lane 4 : Pig uterus lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 18 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for UBE2I / UBC9 (green) using ab233224 at 20 μg/ml in ICC/IF. FITC staining.

References

ab233224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up