Overview

  • Product name

  • Description

    Rabbit polyclonal to UBE2Z
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human UBE2Z aa 115-354.
    Sequence:

    PPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPR VKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQ SLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCP EPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLL MRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV


    Database link: Q9H832-1

  • Positive control

    • WB: MCF7, HeLa and HepG2 whole cell lysates; Mouse gonadal tissue lysate. IHC-P: Human testis and brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab229921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 38 kDa (predicted molecular weight: 39, 29 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for UBE1L2, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation.
  • Tissue specificity

    Widely expressed. Highly in placenta, pancreas, spleen and testis.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ13855 antibody
    • GC17P044341 antibody
    • HOYS7 antibody
    • Uba6 specific E2 conjugating enzyme 1 antibody
    • UBA6 specific enzyme E2 antibody
    • Uba6-specific E2 conjugating enzyme 1 antibody
    • UBE2Z antibody
    • UBE2Z_HUMAN antibody
    • Ubiquitin carrier protein Z antibody
    • Ubiquitin conjugating enzyme E2 Z antibody
    • Ubiquitin conjugating enzyme E2Z antibody
    • Ubiquitin protein ligase Z antibody
    • Ubiquitin-conjugating enzyme E2 Z antibody
    • Ubiquitin-protein ligase Z antibody
    • Use1 antibody
    see all

Images

  • All lanes : Anti-UBE2Z antibody (ab229921) at 1/1000 dilution

    Lane 1 : MCF7 (Human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 4 : Mouse gonadal tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 39, 29 kDa

  • Paraffin-embedded human testis tissue stained for UBE2Z with ab229921 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for UBE2Z with ab229921 at a 1/100 dilution in immunohistochemical analysis.

References

ab229921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up