Anti-UBE3A antibody (ab235984)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-UBE3A antibody
See all UBE3A primary antibodies -
Description
Rabbit polyclonal to UBE3A -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human UBE3A aa 83-234.
Sequence:CDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEK VYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQ AKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDV SV
Database link: 05086 -
Positive control
- IHC-P: Human liver cancer tissue. ICC/IF: HeLa cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235984 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/50 - 1/200. | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates. Several substrates have been identified including the RAD23A and RAD23B, MCM7 (which is involved in DNA replication), annexin A1, the PML tumor suppressor, and the cell cycle regulator CDKN1B. Catalyzes the high-risk human papilloma virus E6-mediated ubiquitination of p53/TP53, contributing to the neoplastic progression of cells infected by these viruses. Additionally, may function as a cellular quality control ubiquitin ligase by helping the degradation of the cytoplasmic misfolded proteins. Finally, UBE3A also promotes its own degradation in vivo. Plays an important role in the regulation of the circadian clock: involved in the ubiquitination of the core clock component ARNTL/BMAL1, leading to its proteasomal degradation (PubMed:24728990). -
Pathway
Protein modification; protein ubiquitination. -
Involvement in disease
Angelman syndrome -
Sequence similarities
Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. -
Post-translational
modificationsPhosphorylation at Tyr-659 by ABL1 impairs E3 ligase activity and protects p53/TP53 from degradation in (HPV)-infected cells. -
Cellular localization
Nucleus. Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 7337 Human
- Omim: 601623 Human
- SwissProt: Q05086 Human
- Unigene: 598862 Human
-
Alternative names
- ANCR antibody
- Angelman syndrome antibody
- AS antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBE3A antibody (ab235984)
Paraffin-embedded human liver cancer tissue stained for UBE3A using ab235984 at 1/100 dilution in immunohistochemical analysis.
-
HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for UBE3A (green) using ab235984 at 1/100 dilution in ICC/IF, followed by an Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).
References
ab235984 has not yet been referenced specifically in any publications.