Anti-UBE3C antibody (ab243830)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-UBE3C antibody
See all UBE3C primary antibodies -
Description
Rabbit polyclonal to UBE3C -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human UBE3C aa 581-679.
Sequence:VTTSSEMQQCIQMEQKRWIQLFKVITNLVKMLKSRDTRRNFCPPNHWLSE QEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSE
Database link: Q15386 -
Positive control
- IHC-P: Human skeletal muscle tissue. ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab243830 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. | |
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
E3 ubiquitin-protein ligase that accepts ubiquitin from the E2 ubiquitin-conjugating enzyme UBE2D1 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Can assemble unanchored poly-ubiquitin chains in either 'Lys-29'- or 'Lys-48'-linked polyubiquitin chains. Has preference for 'Lys-48' linkages. It can target itself for ubiquitination in vitro and may promote its own degradation in vivo. -
Tissue specificity
Highly expressed in skeletal muscle. Detected at much lower levels in kidney and pancreas. -
Pathway
Protein modification; protein ubiquitination. -
Sequence similarities
Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
Contains 1 IQ domain. -
Domain
The C-terminal is necessary and sufficient for the poly-ubiquitin chain assembly. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 9690 Human
- Omim: 614454 Human
- SwissProt: Q15386 Human
- Unigene: 118351 Human
-
Alternative names
- HectH2 antibody
- KIAA0010 antibody
- KIAA10 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-UBE3C antibody (ab243830)PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling UBE3C using ab243830 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBE3C antibody (ab243830)Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for UBE3C using ab243830 at 1/200 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab243830 has not yet been referenced specifically in any publications.
