Overview

  • Product name

    Anti-UBE3D antibody
  • Description

    Rabbit polyclonal to UBE3D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human UBE3D.
    Sequence:

    SLVIESLRNSKYIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLV SLWESDISVHPLTLPSATCLELLL

  • Positive control

    • Human heart muscle tissue; RT 4, U 251 MG, Human liver and tonsil lysate.
  • General notes

     This product was previously labelled as UBE2CBP

     

Properties

Applications

Our Abpromise guarantee covers the use of ab121927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

WB 1/250 - 1/500.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome.
  • Pathway

    Protein modification; protein ubiquitination.
  • Domain

    The C-terminal half (AA 188-389) is able to bind cyclin B and shows a self-ubiquitinylation activity (mono-, poly, or multi-ubiquitinylation) in a HECT-like sequence dependent manner.
  • Post-translational
    modifications

    Ubiquitinated by UBCH10 (E2 ubiquitin-conjugating enzyme).
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • C6orf157 antibody
    • chromosome 6 open reading frame 157 antibody
    • DKFZp434A1520 antibody
    • EC 6.3.2 antibody
    • EC 6.3.2.- antibody
    • H10BH antibody
    • MGC126561 antibody
    • MGC126587 antibody
    • OTTHUMP00000016789 antibody
    • OTTHUMP00000220801 antibody
    • UB2CB_HUMAN antibody
    • UBCH10 binding protein with a hect-like domain antibody
    • UbcH10-binding protein with a HECT-like domain antibody
    • UBE2CBP antibody
    • Ubiquitin-conjugating enzyme E2C-binding protein antibody
    • YJR141W antibody
    see all

Images

  • Immunofluorescent staining of Human cell line U-2 OS shows positivity in mitochondria. Recommended concentration of ab121927 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • All lanes : Anti-UBE3D antibody (ab121927) at 1/250 dilution

    Lane 1 : RT 4 cell line lysate
    Lane 2 : U 251 MG cell line lysate

    Lane 3 : Human plasma lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate
  • ab121927, at 1/20, staining UBE3D in paraffin embedded Human heart muscle tissue by Immunohistochemistry.

References

ab121927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (Hap1 (chronic myeloid leukemia))
Gel Running Conditions
Reduced Denaturing (4-20% polyacrylamide)
Loading amount
10 µg
Specification
Hap1 (chronic myeloid leukemia)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C

Kaili Carr

Verified customer

Submitted Nov 27 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up