Overview

  • Product name

  • Description

    Rabbit polyclonal to Ube4a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Ube4a aa 797-1066.
    Sequence:

    FLLDEAIQYLSKIKIQQIEKDRGEWDSLTPEARREKEAGLQMFGQLARFH NIMSNETIGTLAFLTSEIKSLFVHPFLAERIISMLNYFLQHLVGPKMGAL KVKDFSEFDFKPQQLVSDICTIYLNLGDEENFCATVPKDGRSYSPTLFAQ TVRVLKKINKPGNMIMAFSNLAERIKSLADLQQQEEETYADACDEFLDPI MSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTE LKEKIQRWLAERKQQKEQLE


    Database link: Q14139

  • Positive control

    • WB: K562, MCF7, Jurkat, Caco-2, HepG2 and HEK-293T whole cell lysate. IHC-P: Human glioma and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 123 kDa (predicted molecular weight: 123, 124 kDa).

Target

Images

  • All lanes : Anti-Ube4a antibody (ab230315) at 1/1000 dilution

    Lane 1 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 2 : MCF7 (Human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 4 : Caco-2 (Human colorectal adenocarcinoma cell line) whole cell lysate
    Lane 5 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 6 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 123, 124 kDa
    Observed band size: 123 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human glioma tissue stained for Ube4a with ab230315 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for Ube4a with ab230315 at 1/100 dilution in immunohistochemical analysis.

References

ab230315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up