Overview

  • Product name

  • Description

    Rabbit polyclonal to UBF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human UBF1 aa 332-453.
    Sequence:

    WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLN INKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPE LSESELTRLLARMWNDLSEKKK


    Database link: P17480

  • Positive control

    • IHC-P: Human cerebral cortex, hippocampus and skin tissues; Mouse retrosplenial granular cortex and thalamus tissues. WB: U-2 OS cell lysate transfected with control siRNA; Human and mouse cerebral cortex lysates. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 89 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Recognizes the ribosomal RNA gene promoter and activates transcription mediated by RNA polymerase I through cooperative interactions with the transcription factor SL1/TIF-IB complex. It binds specifically to the upstream control element.
  • Sequence similarities

    Contains 6 HMG box DNA-binding domains.
  • Post-translational
    modifications

    Phosphorylated and activated by PIK3CA.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 90 kDa nucleolus organizer region autoantigen antibody
    • Autoantigen NOR-90 antibody
    • NOR 90 antibody
    • Nucleolar transcription factor 1 antibody
    • UBF 1 antibody
    • UBF antibody
    • UBF-1 antibody
    • UBF1_HUMAN antibody
    • Ubtf antibody
    • Upstream binding factor 1 antibody
    • upstream binding transcription factor, RNA polymerase I antibody
    • Upstream-binding factor 1 antibody
    see all

Images

  • All lanes : Anti-UBF1 antibody (ab244287) at 0.4 µg/ml

    Lane 1 : U-2 OS (human bone osteosarcoma epithelial cell line) treated with control siRNA, whole cell lysate
    Lane 2 : U-2 OS treated with target-specific siRNA #1, whole cell lysate
    Lane 3 : U-2 OS treated with target-specific siRNA #2, whole cell lysate

    Predicted band size: 89 kDa



    Remaining relative intensity is shown.

    Loading control: GAPDH.

  • Paraffin-embedded mouse thalamus tissue stained for UBF1 using ab244287 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for UBF1 using ab244287 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2OS (human bone osteosarcoma epithelial cell line) cells stained for UBF1 (green) using ab244287 at 4 µg/ml in ICC/IF.

  • Anti-UBF1 antibody (ab244287) at 0.4 µg/ml + Mouse cerebral cortex lysate

    Predicted band size: 89 kDa

  • Anti-UBF1 antibody (ab244287) at 0.4 µg/ml + Human cerebral cortex lysate

    Predicted band size: 89 kDa

  • All lanes : Anti-UBF1 antibody (ab244287) at 0.4 µg/ml

    Lane 1 : U-2OS (human bone osteosarcoma epithelial cell line) cell lysate transfected with control siRNA
    Lane 2 : U-2OS cell lysate transfected with siRNA probe 1
    Lane 3 : U-2OS cell lysate transfected with siRNA probe 2

    Predicted band size: 89 kDa

  • Paraffin-embedded mouse retrosplenial granular cortex tissue stained for UBF1 using ab244287 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human hippocampus tissue stained for UBF1 using ab244287 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebral cortex tissue stained for UBF1 using ab244287 at 1/200 dilution in immunohistochemical analysis.

References

ab244287 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up