Overview

  • Product name
  • Description
    Mouse polyclonal to Ubiquitin D
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Ubiquitin D aa 1-165.
    Sequence:

    MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVL LLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAK RHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGI RKGNLLFLASYCIGG


    Database link: O15205

  • Positive control
    • Ubiquitin D transfected 293T cell lysate; HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab168680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 18 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Ubiquitin-like protein modifier which can be covalently attached to target protein and subsequently leads to their degradation by the 26S proteasome, in a NUB1L-dependent manner. Probably functions as a survival factor. Conjugation ability activated by UBA6. Promotes the expression of the proteasome subunit beta type-9 (PSMB9/LMP2). Regulates TNF-alpha-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-alpha-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha. Required for TNF-alpha-induced p65 nuclear translocation in renal tubular epithelial cells (RTECs). May be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T cell responses. Mediates mitotic non-disjunction and chromosome instability, in long-term in vitro culture and cancers, by abbreviating mitotic phase and impairing the kinetochore localization of MAD2L1 during the prometaphase stage of the cell cycle. May be involved in the formation of aggresomes when proteasome is saturated or impaired. Mediates apoptosis in a caspase-dependent manner, especially in renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV)-associated nephropathy (HIVAN).
  • Tissue specificity
    Constitutively expressed in mature dendritic cells and B cells. Mostly expressed in the reticuloendothelial system (e.g. thymus, spleen), the gastrointestinal system, kidney, lung and prostate gland.
  • Sequence similarities
    Contains 2 ubiquitin-like domains.
  • Post-translational
    modifications
    Can be acetylated.
  • Cellular localization
    Nucleus. Cytoplasm. Accumulates in aggresomes under proteasome inhibition conditions.
  • Information by UniProt
  • Database links
  • Alternative names
    • Diubiquitin antibody
    • FAT10 antibody
    • GABBR1 antibody
    • UBD 3 antibody
    • Ubd antibody
    • UBD_HUMAN antibody
    • Ubiquitin D antibody
    • Ubiquitin like protein FAT10 antibody
    • Ubiquitin-like protein FAT10 antibody
    see all

Images

  • All lanes : Anti-Ubiquitin D antibody (ab168680) at 1 µg/ml

    Lane 1 : Diubiquitin transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate


    Lysates/proteins at 15 µg per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 18 kDa

  • Immunofluorescence analysis of HeLa cells labeling Ubiquitin D with ab168680 at 10µg/ml.

References

ab168680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up