Anti-UBN1 antibody (ab220945)
Key features and details
- Rabbit polyclonal to UBN1
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-UBN1 antibody
See all UBN1 primary antibodies -
Description
Rabbit polyclonal to UBN1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human UBN1 aa 587-675.
Sequence:AKKKVMAPSKIKVKESSTKPDKKVSVPSGQIGGPIALPSDHQTGGLSIGA SSRELPSQASGGLANPPPVNLEDSLDEDLIRNPASSVEA
Database link: Q9NPG3 -
Positive control
- SiHa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220945 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Relevance
UBN1 may be required for replication independent chromatin assembly, and interacts with epstein-barr virus BZLF1 and CEBPA. It is ubiquitous, and is also expressed in numerous tumours and cancer cell lines. Interacts with epstein-barr virus BZLF1 and CEBPA. -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 29855 Human
- Omim: 609771 Human
- SwissProt: Q9NPG3 Human
- Unigene: 440219 Human
-
Alternative names
- Ubinuclein 1 antibody
- Ubinuclein antibody
- Ubiquitously expressed nuclear protein antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-UBN1 antibody (ab220945)
Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SiHa cells labeling UBN1 with ab220945 at 4 μg/ml (green).
Protocols
Datasheets and documents
References (0)
ab220945 has not yet been referenced specifically in any publications.
