For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    ubp43usp18-antibody-ab168478.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Proteolysis / Ubiquitin Proteasome / Ubiquitin Deubiquitination
Share by email

Anti-UBP43/USP18 antibody (ab168478)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-UBP43/USP18 antibody (ab168478)
  • Immunocytochemistry/ Immunofluorescence - Anti-UBP43/USP18 antibody (ab168478)

Key features and details

  • Mouse polyclonal to UBP43/USP18
  • Suitable for: WB, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Primary
Product image
Anti-ISG15 antibody [EPR3446] (ab133346)
Primary
Product image
Anti-ISG20 antibody (ab154393)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-UBP43/USP18 antibody
  • Description

    Mouse polyclonal to UBP43/USP18
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Full length protein corresponding to Human UBP43/USP18 aa 1-372.
    Sequence:

    MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDY PHGLVGLHNIGQTCCLNSLIQVFVMNVDFTRILKRITVPRGADEQRRSVP FQMLLLLEKMQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNL IKDQITDVHLVERLQALYTIRVKDSLICVDCAMESSRNSSMLTLPLSLFD VDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQ TLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG QYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCT YGNPNYHWQETAYLLVYMKMEC


    Database link: NP_059110.2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • UBP43/USP18 transfected 293T cell line lysate; HeLa cells.
  • General notes

     This product was previously labelled as UBP43

     

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.4
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Deubiquitination
    • Epigenetics and Nuclear Signaling
    • Ubiquitin & Ubiquitin Like Modifiers
    • Deubiquitination

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG - Isotype Control (ab37355)
  • Recombinant Protein

    • Recombinant Human UBP43/USP18 protein (ab161390)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab168478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.
ICC/IF
Use a concentration of 10 µg/ml.
Notes
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.
ICC/IF
Use a concentration of 10 µg/ml.

Target

  • Function

    Can efficiently cleave only ISG15 fusions including native ISG15 conjugates linked via isopeptide bonds. Necessary to maintain a critical cellular balance of ISG15-conjugated proteins in both healthy and stressed organisms.
  • Sequence similarities

    Belongs to the peptidase C19 family.
  • Target information above from: UniProt accession Q9UMW8 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 11274 Human
    • Entrez Gene: 100171781 Orangutan
    • Omim: 607057 Human
    • SwissProt: Q9UMW8 Human
    • SwissProt: Q5RE63 Orangutan
    • Unigene: 38260 Human
    • Alternative names

      • 43 kDa ISG15 specific protease antibody
      • 43 kDa ISG15-specific protease antibody
      • EC 3.1.2. antibody
      • hUBP43 antibody
      • Interferon Stimulated Gene 43 kD antibody
      • ISG15 Specific Processing Protease antibody
      • ISG15-specific-processing protease antibody
      • ISG43 antibody
      • Ubiquitin Specific Peptidase 18 antibody
      • Ubiquitin Specific Protease 18 43 kD antibody
      • Ubiquitin Specific Protease 18 antibody
      • Ubl carboxyl terminal hydrolase 18 antibody
      • Ubl carboxyl-terminal hydrolase 18 antibody
      • Ubl thioesterase 18 antibody
      • Ubl thiolesterase 18 antibody
      • Ubp15 antibody
      • UBP18_HUMAN antibody
      • USP18 antibody
      see all

    Images

    • Western blot - Anti-UBP43/USP18 antibody (ab168478)
      Western blot - Anti-UBP43/USP18 antibody (ab168478)
      All lanes : Anti-UBP43/USP18 antibody (ab168478) at 1 µg/ml

      Lane 1 : UBP43/USP18 transfected 293T cell line lysate
      Lane 2 : Non-transfected 293T cell line lysate

      Lysates/proteins at 15 µl per lane.

      Predicted band size: 43 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-UBP43/USP18 antibody (ab168478)
      Immunocytochemistry/ Immunofluorescence - Anti-UBP43/USP18 antibody (ab168478)

    Protocols

    • Western blot protocols
    • Immunocytochemistry & immunofluorescence protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab168478? Please let us know so that we can cite the reference in this datasheet.

    ab168478 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab168478.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.