Overview

  • Product name
  • Description
    Mouse polyclonal to UBP43/USP18
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Full length protein corresponding to Human UBP43/USP18 aa 1-372.
    Sequence:

    MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDY PHGLVGLHNIGQTCCLNSLIQVFVMNVDFTRILKRITVPRGADEQRRSVP FQMLLLLEKMQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNL IKDQITDVHLVERLQALYTIRVKDSLICVDCAMESSRNSSMLTLPLSLFD VDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQ TLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG QYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCT YGNPNYHWQETAYLLVYMKMEC


    Database link: NP_059110.2

  • Positive control
    • UBP43/USP18 transfected 293T cell line lysate; HeLa cells.
  • General notes

     This product was previously labelled as UBP43

     

Properties

Applications

Our Abpromise guarantee covers the use of ab168478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Can efficiently cleave only ISG15 fusions including native ISG15 conjugates linked via isopeptide bonds. Necessary to maintain a critical cellular balance of ISG15-conjugated proteins in both healthy and stressed organisms.
  • Sequence similarities
    Belongs to the peptidase C19 family.
  • Information by UniProt
  • Database links
  • Alternative names
    • 43 kDa ISG15 specific protease antibody
    • 43 kDa ISG15-specific protease antibody
    • EC 3.1.2. antibody
    • hUBP43 antibody
    • Interferon Stimulated Gene 43 kD antibody
    • ISG15 Specific Processing Protease antibody
    • ISG15-specific-processing protease antibody
    • ISG43 antibody
    • Ubiquitin Specific Peptidase 18 antibody
    • Ubiquitin Specific Protease 18 43 kD antibody
    • Ubiquitin Specific Protease 18 antibody
    • Ubl carboxyl terminal hydrolase 18 antibody
    • Ubl carboxyl-terminal hydrolase 18 antibody
    • Ubl thioesterase 18 antibody
    • Ubl thiolesterase 18 antibody
    • Ubp15 antibody
    • UBP18_HUMAN antibody
    • USP18 antibody
    see all

Images

  • All lanes : Anti-UBP43/USP18 antibody (ab168478) at 1 µg/ml

    Lane 1 : UBP43/USP18 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 43 kDa

References

ab168478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up