Overview

  • Product name

  • Description

    Rabbit polyclonal to UBP43/USP18
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cat, Dog, Pig, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human UBP43/USP18 aa 110-159 (N terminal).
    Sequence:

    MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH

  • Positive control

    • HeLa cell lysate.
  • General notes

     This product was previously labelled as UBP43

     

Properties

Applications

Our Abpromise guarantee covers the use of ab80815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 43 kDa (predicted molecular weight: 43 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.

Target

  • Function

    Can efficiently cleave only ISG15 fusions including native ISG15 conjugates linked via isopeptide bonds. Necessary to maintain a critical cellular balance of ISG15-conjugated proteins in both healthy and stressed organisms.
  • Sequence similarities

    Belongs to the peptidase C19 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 43 kDa ISG15 specific protease antibody
    • 43 kDa ISG15-specific protease antibody
    • EC 3.1.2. antibody
    • hUBP43 antibody
    • Interferon Stimulated Gene 43 kD antibody
    • ISG15 Specific Processing Protease antibody
    • ISG15-specific-processing protease antibody
    • ISG43 antibody
    • Ubiquitin Specific Peptidase 18 antibody
    • Ubiquitin Specific Protease 18 43 kD antibody
    • Ubiquitin Specific Protease 18 antibody
    • Ubl carboxyl terminal hydrolase 18 antibody
    • Ubl carboxyl-terminal hydrolase 18 antibody
    • Ubl thioesterase 18 antibody
    • Ubl thiolesterase 18 antibody
    • Ubp15 antibody
    • UBP18_HUMAN antibody
    • USP18 antibody
    see all

Images

  • Anti-UBP43/USP18 antibody (ab80815) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa
    Observed band size: 43 kDa
    Additional bands at: 90 kDa. We are unsure as to the identity of these extra bands.



    Gel concentration: 12%

References

ab80815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab80815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up