Overview

  • Product name

    Anti-UBR3 antibody
  • Description

    Mouse polyclonal to UBR3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human UBR3 aa 1148-1888.
    Sequence:

    MNKRIIEEICRKVTPPVPPKKVTAAEKKTLDKEERRQKARERQQKLLAEF ASRQKSFMETAMDVDSPENDIPMEITTAEPQVSEAVYDCVICGQSGPSSE DRPTGLVVLLQASSVLGQCRDNVEPKKLPISEEEQIYPWDTCAAVHDVRL SLLQRYFKDSSCLLAVSIGWEGGVYVQTCGHTLHIDCHKSYMESLRNDQV LQGFSVDKGEFTCPLCRQFANSVLPCYPGSNVENNPWQRPSNKSIQDLIK EVEELQGRPGAFPSETNLSKEMESVMKDIKNTTQKKYRDYSKTPGSPDND FLFMYSVARTNLELELIHRGGNLCSGGASTAGKRSCLNQLFHVLALHMRL YSIDSEYNPWRKLTQLEEMNPQLGYEEQQPEVPILYHDVTSLLLIQILMM PQPLRKDHFTCIVKVLFTLLYTQALAALSVKCSEEDRSAWKHAGALKKST CDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQ DFCLPFLRITSLLQHHLFGEDLPSCQEEEEFSVLASCLGLLPTFYQTEHP FISASCLDWPVPAFDIITQWCFEIKSFTERHAEQGKALLIQESKWKLPHL LQLPENYNTIFQYYHRKTCSVCTKVPKDPAVCLVCGTFVCLKGLCCKQQS YCECVLHSQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDR DLRRGKPLYICKERYKVLEQQWISHTFDHINKRWGPHYNGL


    Database link: NP_742067.2

  • Positive control

    • UBR3 transfected 293T cell lysate.
  • General notes

    Previously labelled as ZNF650.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 212 kDa.

Target

  • Function

    E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Does not bind to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the UBR1 family.
    Contains 1 RING-type zinc finger.
    Contains 1 UBR-type zinc finger.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp434P117 antibody
    • DKFZp686N10185 antibody
    • E3 ubiquitin-protein ligase UBR3 antibody
    • FLJ37422 antibody
    • KIAA2024 antibody
    • MGC126489 antibody
    • N-recognin-3 antibody
    • Ubiquitin-protein ligase E3-alpha-3 antibody
    • Ubiquitin-protein ligase E3-alpha-III antibody
    • Ubr3 antibody
    • UBR3_HUMAN antibody
    • Zinc finger protein 650 antibody
    • ZNF 650 antibody
    • ZNF650 antibody
    see all

Images

  • All lanes : Anti-UBR3 antibody (ab169188) at 1 µg/ml

    Lane 1 : UBR3 transfected 293T cell lysate (81.51 KDa)
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 212 kDa

References

ab169188 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up