Overview

  • Product name

  • Description

    Rabbit polyclonal to UBR7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human UBR7 aa 10-148.
    Sequence:

    RQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALY ACSTCTPEGEEPAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNL ECKLLPDKAKVNSGNKYNDNFFGLYCICKRPYPDPEDEI


    Database link: Q8N806

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: A431 cells.
  • General notes

    Previously labelled as C14orf130.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    UBR7 is a putative E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific amino-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
  • Database links

  • Alternative names

    • 5730410I19Rik antibody
    • AA589405 antibody
    • AW557761 antibody
    • C14orf130 antibody
    • Chromosome 14 open reading frame 130 antibody
    • EC 6.3.2.- antibody
    • FLJ10483 antibody
    • MGC94098 antibody
    • MGC9518 antibody
    • N recognin 7 antibody
    • Putative E3 ubiquitin-protein ligase UBR7 antibody
    • RGD1359144 antibody
    • Ubiquitin protein ligase E3 component n-recognin 7 (putative) antibody
    • UBR7 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for UBR7 using ab224216 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for UBR7 (green) using ab224216 at 4 µg/ml in ICC/IF.

References

ab224216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up