Overview

  • Product name

  • Description

    Rabbit polyclonal to UBXD8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide corresponding to Human UBXD8 aa 383-445.
    Sequence:

    SLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLS HTEVLFVQDLTDE


    Database link: NP_055428

  • Positive control

    • WB: H1299 and HeLa cel lysates. IHC-P: Mouse intestine tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as ETEA

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.00
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 1.21% Tris, 0.75% Glycine, 20% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab96673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100 - 1/1000.
IHC-P 1/100 - 1/1000.
WB 1/1000. Predicted molecular weight: 53 kDa.

Target

  • Function

    May play a role in the translocation of terminally misfolded proteins from the endoplasmic reticulum lumen to the cytoplasm and their degradation by the proteasome.
  • Tissue specificity

    Broadly expressed, with highest levels in brain.
  • Sequence similarities

    Contains 1 UBA domain.
    Contains 1 UBX domain.
  • Cellular localization

    Cytoplasm. Lipid droplet. Endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI462440 antibody
    • expressed in T cells and eosinophils in atopic dermatitis antibody
    • faf2 antibody
    • FAF2_HUMAN antibody
    • Fas associated factor family member 2 antibody
    • FAS-associated factor 2 antibody
    • KIAA0887 antibody
    • Protein ETEA antibody
    • Protein expressed in T cells and eosinophils in atopic dermatitis antibody
    • Protein expressed in T-cells and eosinophils in atopic dermatitis antibody
    • UBX domain containing 8 antibody
    • UBX domain protein 3B antibody
    • UBX domain-containing protein 3B antibody
    • UBX domain-containing protein 8 antibody
    • UBXD8 antibody
    • UBXN3B antibody
    see all

Images

  • All lanes : Anti-UBXD8 antibody (ab96673) at 1/1000 dilution

    Lane 1 : H1299 whole cell lysate
    Lane 2 : HeLa whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 53 kDa



    10% SDS PAGE
  • 4% paraformaldehyde-fixed HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling UBXD8 using ab96673 at 1/500 dilution (green) in ICC/IF. The nuclear counter stain is Hoechst 33343 (blue).

  • Paraffin-embedded mouse intestine tissue labeling UBXD8 using ab96673 at1/500 dilution in immunohistochemical analysis.

    Antigen retrieval: EDTA-based (pH8.0), 15 minutes.

References

ab96673 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab96673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up