Overview

  • Product name

    Anti-UBXN2B antibody [OTI3H8]
  • Description

    Mouse monoclonal [OTI3H8] to UBXN2B
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Dog, Human, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Human UBXN2B aa 2-331. Produced in HEK293T cells (NP_001071087).
    Sequence:

    AEGGGPEPGEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKA TVFKSPRTPPQRFYSSEHEYSGLNIVRPSTGKIVNELFKEAREHGAVPLN EATRASGDDKSKSFTGGGYRLGSSFCKRSEYIYGENQLQDVQILLKLWSN GFSLDDGELRPYNEPTNAQFLESVKRGEIPLELQRLVHGGQVNLDMEDHQ DQEYIKPRLRFKAFSGEGQKLGSLTPEIVSTPSSPEEEDKSILNAVVLID DSVPTTKIQIRLADGSRLIQRFNSTHRILDVRNFIVQSRPEFAALDFILV TSFPNKELTDESLTLLEADILNTVLLQQLK


    Database link: Q14CS0

  • Positive control

    • WB: HEK293T cell lysate transfected with pCMV6-ENTRY UBXN2B cDNA; HepG2, HeLa, HT29, A549, COS-7, Jurkat, MDCK and MCF7 cell extracts Flow Cyt: HEK293T cells transfected with a UBXN2B overexpress plasmid

Properties

Applications

Our Abpromise guarantee covers the use of ab124032 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 37 kDa.
Flow Cyt 1/100.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Adapter protein required for Golgi and endoplasmic reticulum biogenesis. Involved in Golgi and endoplasmic reticulum maintenance during interphase and in their reassembly at the end of mitosis. The complex formed with VCP has membrane fusion activity; membrane fusion activity requires USO1-GOLGA2 tethering and BET1L. VCPIP1 is also required, but not its deubiquitinating activity.
  • Sequence similarities

    Belongs to the NSFL1C family.
    Contains 1 SEP domain.
    Contains 1 UBX domain.
  • Cellular localization

    Nucleus. Cytoplasm > cytosol. Endoplasmic reticulum. Golgi apparatus.
  • Information by UniProt
  • Database links

  • Alternative names

    • NSFL1 cofactor p37 antibody
    • p37 antibody
    • p97 cofactor p37 antibody
    • UBX domain containing protein 2B antibody
    • UBX domain protein 2B antibody
    • UBX domain-containing protein 2B antibody
    • UBX2B_HUMAN antibody
    • UBXN2B antibody
    see all

Images

  • All lanes : Anti-UBXN2B antibody [OTI3H8] (ab124032) at 1/1000 dilution

    Lane 1 : Human testis tissue extract
    Lane 2 : Human omentum tissue extract
    Lane 3 : Human uterus tissue extract
    Lane 4 : Human breast tissue extract
    Lane 5 : Human brain tissue extract
    Lane 6 : Human liver tissue extract
    Lane 7 : Human ovary tissue extract
    Lane 8 : Human thyroid gland tissue extract
    Lane 9 : Human colon tissue extract
    Lane 10 : Human spleen tissue extract

    Predicted band size: 37 kDa

  • All lanes : Anti-UBXN2B antibody [OTI3H8] (ab124032) at 1/1000 dilution

    Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY UBXN2B cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 37 kDa



    HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC205243)
  • ab124032, at a 1/100 dilution, staining UBXN2B in HEK293T cells transfected with a UBXN2B overexpress plasmid (Red) or empty vector control plasmid (Blue) by Flow Cytometry.

References

ab124032 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124032.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up