Overview

  • Product name

  • Description

    Rabbit polyclonal to UBXN6/UBXD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human UBXN6/UBXD1 aa 3-70.
    Sequence:

    KFFQEFKADIKFKSAGPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEA QMAAAAALARLEQKQSRA


    Database link: Q9BZV1

  • Positive control

    • HEK293 cells; RT4 and U251 MG cell lysates.
  • General notes

     This product was previously labelled as UBXN6

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100
WB 1/500 - 1/1000. Predicted molecular weight: 49 kDa.

Target

  • Function

    Acts in a complex with VCP and cooperates with USP7 in promoting MDM2 deubiquitination and stabilization. MDM2 stabilization leads to MDM2-dependent TP53 degradation.
  • Tissue specificity

    Enhanced expression in testis.
  • Sequence similarities

    Contains 1 PUB (PUG) domain.
    Contains 1 UBX domain.
  • Domain

    The UBX domain lacks key residues critical for VCP binding.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Localizes at the centrosome both in interphase and during mitosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • UBX domain containing 1 antibody
    • UBX domain containing 2 antibody
    • UBX domain containing protein 1 antibody
    • UBX domain containing protein 6 antibody
    • UBX domain protein 6 antibody
    • UBX domain-containing protein 1 antibody
    • UBX domain-containing protein 6 antibody
    • UBXD1 antibody
    • UBXDC2 antibody
    • Ubxn6 antibody
    • UBXN6_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized HEK293 cells labeling UBXN6/UBXD1 with ab221167 at 4 μg/ml (green).

  • All lanes : Anti-UBXN6/UBXD1 antibody (ab221167) at 1/500 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251 MG cell lysate

    Predicted band size: 49 kDa

References

ab221167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up