Overview

  • Product name

  • Description

    Rabbit polyclonal to UCH37
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Pig
  • Immunogen

    Fusion protein corresponding to Human UCH37 aa 1-326. (Full length, BC025369).
    Sequence:

    MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVH GLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNC THQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFE FDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAV RPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTD QGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLK TLAEHQQLIPLVEKFEKHFEKTLLGK


    Database link: Q9Y5K5-4

  • Positive control

    • Human fetal kidney and 293T lysatse; Human thyroid tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/25 - 1/100.
WB 1/200 - 1/1000. Predicted molecular weight: 37 kDa.

Target

  • Function

    Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome.
  • Sequence similarities

    Belongs to the peptidase C12 family.
  • Cellular localization

    Cytoplasm. Nucleus. Associates with the proteasome 19S subunit in the cytoplasm. Associates with the INO80 complex in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • UCH37 antibody
    • AD-019 antibody
    • CGI 70 antibody
    • INO80 complex subunit R antibody
    • INO80R antibody
    • Ubiquitin C terminal hydrolase L5 antibody
    • Ubiquitin C terminal hydrolase UCH37 antibody
    • Ubiquitin C-terminal hydrolase UCH37 antibody
    • Ubiquitin carboxyl terminal esterase L5 antibody
    • Ubiquitin carboxyl terminal hydrolase isozyme L5 antibody
    • Ubiquitin carboxyl terminal hydrolase L5 antibody
    • Ubiquitin carboxyl-terminal hydrolase isozyme L5 antibody
    • Ubiquitin thioesterase L5 antibody
    • Ubiquitin thiolesterase L5 antibody
    • UCH L5 antibody
    • UCH-L5 antibody
    • UCHL5 antibody
    • UCHL5_HUMAN antibody
    see all

Images

  • All lanes : Anti-UCH37 antibody (ab197843) at 1/250 dilution

    Lane 1 : Human fetal kidney tissue lysate
    Lane 2 : 293T cell lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 37 kDa


    Exposure time: 15 seconds


    Gel: 12%SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded Human thyroid cancer tissue labeling UCH37 with ab197843 at 1/25 dilution.

References

ab197843 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197843.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up