Anti-UCHL3 antibody (ab244371)

Submit a review Submit a question

Overview

  • Product name

    Anti-UCHL3 antibody
    See all UCHL3 primary antibodies

  • Description

    Rabbit polyclonal to UCHL3

  • Host species

    Rabbit

  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig

  • Immunogen

    Recombinant fragment corresponding to Human UCHL3 aa 1-93.
    Sequence:

    MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC AVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISN


    Database link: P15374

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: Human testis, colon, rectum and prostate tissue. WB: RT4 and U-251 MG cell lysate. Human liver and tonsil tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3". Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory.

  • Tissue specificity

    Highly expressed in heart, skeletal muscle, and testis.

  • Sequence similarities

    Belongs to the peptidase C12 family.

  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.

  • Cellular localization

    Cytoplasm.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • Ubiquitin carboxyl-terminal hydrolase isozyme L3 antibody
    • Ubiquitin thioesterase L3 antibody
    • Ubiquitin thiolesterase antibody
    • Ubiquitin thiolesterase L3 antibody
    • UCH L3 antibody
    • UCH-L3 antibody
    • UCHL3 antibody
    • UCHL3_HUMAN antibody
    see all

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-UCHL3 antibody (ab244371)
    Immunocytochemistry/ Immunofluorescence - Anti-UCHL3 antibody (ab244371)

    PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for UCHL3 (green) using ab244371 at 4 µg/ml in ICC/IF.

  • Western blot - Anti-UCHL3 antibody (ab244371)
    Western blot - Anti-UCHL3 antibody (ab244371)
    All lanes : Anti-UCHL3 antibody (ab244371) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)

    Paraffin-embedded human testis tissue stained for UCHL3 using ab244371 at 1/50 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)

    Paraffin-embedded human prostate tissue stained for UCHL3 using ab244371 at 1/50 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)

    Paraffin-embedded human rectum tissue stained for UCHL3 using ab244371 at 1/50 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)

    Paraffin-embedded human colon tissue stained for UCHL3 using ab244371 at 1/50 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)

    Paraffin-embedded human pancreas tissue stained for UCHL3 using ab244371 at 1/50 dilution in immunohistochemical analysis.

    No positivity in exocrine glandular cells as expected.

References

ab244371 has not yet been referenced specifically in any publications.

Publishing research using ab244371? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab244371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com