Anti-UCHL3 antibody (ab244371)
Key features and details
- Rabbit polyclonal to UCHL3
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-UCHL3 antibody
See all UCHL3 primary antibodies -
Description
Rabbit polyclonal to UCHL3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Pig -
Immunogen
Recombinant fragment corresponding to Human UCHL3 aa 1-93.
Sequence:MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC AVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISN
Database link: P15374 -
Positive control
- IHC-P: Human testis, colon, rectum and prostate tissue. WB: RT4 and U-251 MG cell lysate. Human liver and tonsil tissue. ICC/IF: A431 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244371 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3". Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory. -
Tissue specificity
Highly expressed in heart, skeletal muscle, and testis. -
Sequence similarities
Belongs to the peptidase C12 family. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 520170 Cow
- Entrez Gene: 7347 Human
- Entrez Gene: 50933 Mouse
- Entrez Gene: 768115 Pig
- Entrez Gene: 498560 Rat
- Omim: 603090 Human
- SwissProt: Q2TBG8 Cow
- SwissProt: P15374 Human
see all -
Alternative names
- Ubiquitin carboxyl-terminal hydrolase isozyme L3 antibody
- Ubiquitin thioesterase L3 antibody
- Ubiquitin thiolesterase antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for UCHL3 (green) using ab244371 at 4 µg/ml in ICC/IF.
-
All lanes : Anti-UCHL3 antibody (ab244371) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)
Paraffin-embedded human testis tissue stained for UCHL3 using ab244371 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)
Paraffin-embedded human prostate tissue stained for UCHL3 using ab244371 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)
Paraffin-embedded human rectum tissue stained for UCHL3 using ab244371 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)
Paraffin-embedded human colon tissue stained for UCHL3 using ab244371 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UCHL3 antibody (ab244371)
Paraffin-embedded human pancreas tissue stained for UCHL3 using ab244371 at 1/50 dilution in immunohistochemical analysis.
No positivity in exocrine glandular cells as expected.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244371 has not yet been referenced specifically in any publications.