Overview

  • Product name

    Anti-UCHL4 antibody
  • Description

    Rabbit polyclonal to UCHL4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Cow, Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse UCHL4 aa 2-233. Expressed in E.coli. N-terminal tags.
    Sequence:

    EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMESELLSIIPRPVCA VLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGTI GLIHAIANNKDKVHFESGSTLKKFLEESVSMSPEERAKYLENYDAIRVTH ETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGWKPFPINHGKTSD ETLLEDVIKVCKKFMERDPDELRFNAIALSAA


    Database link: P58321

  • Positive control

    • IHC-P: Mouse kidney tissue. WB: Mouse lung lysate; Recombinant mouse UCHL4 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab231352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Ubiquitin-protein hydrolase is involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin.
  • Tissue specificity

    Expressed in various tissues at low level.
  • Sequence similarities

    Belongs to the peptidase C12 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ubiquitin carboxyl-terminal hydrolase isozyme L4 antibody
    • Ubiquitin thioesterase L4 antibody
    • UCH-L4 antibody
    • Uchl4 antibody
    • UCHL4_MOUSE antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for UCHL4 using ab231352 at 20 µg/mL in immunohistochemical analysis.

  • Anti-UCHL4 antibody (ab231352) at 3 µg/ml + Mouse lung lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution
  • Anti-UCHL4 antibody (ab231352) at 2 µg/ml + Recombinant mouse UCHL4 protein

References

ab231352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up