Overview

  • Product name

    Anti-UCN2/SRP antibody
  • Description

    Rabbit polyclonal to UCN2/SRP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Cow, Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human UCN2/SRP aa 20-112. Expressed in E.coli.
    Sequence:

    VPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPG SRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC


    Database link: Q96RP3

  • Positive control

    • IHC-P: Human skin cancer tissue. WB: Human urine; Bovine kidney lysate; Rat and pig adrenal gland lysates; Recombinant human UCN2/SRP protein.
  • General notes

     This product was previously labelled as UCN2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 12 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for UCN2/SRP using ab231050 at 20 µg/ml in immunohistochemical analysis.

  • Anti-UCN2/SRP antibody (ab231050) at 2 µg/ml + Human urine

    Predicted band size: 12 kDa

  • Anti-UCN2/SRP antibody (ab231050) at 2 µg/ml + Cow kidney lysate

    Predicted band size: 12 kDa

  • Anti-UCN2/SRP antibody (ab231050) at 2 µg/ml + Pig adrenal gland lysate

    Predicted band size: 12 kDa

  • Anti-UCN2/SRP antibody (ab231050) at 2 µg/ml + Rat adrenal gland lysate

    Predicted band size: 12 kDa

  • Anti-UCN2/SRP antibody (ab231050) at 2 µg/ml + Recombinant human UCN2/SRP protein

    Predicted band size: 12 kDa

References

ab231050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up