Overview

  • Product name

  • Description

    Rabbit polyclonal to UCP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Synthetic peptide within Mouse UCP2 aa 236-268 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    DVVKTRYMNSALGQYHSAGHCALTMLRKEGPRA


    Database link: P70406

  • Positive control

    • Mouse brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 33 kDa.
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 if using a fluorescent secondary antibody)

Target

  • Function

    UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
  • Tissue specificity

    Widely expressed in adult human tissues, including tissues rich in macrophages. Most expressed in white adipose tissue and skeletal muscle.
  • Sequence similarities

    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BMIQ4 antibody
    • Mitochondrial uncoupling protein 2 antibody
    • SLC25A8 antibody
    • Solute carrier family 25 member 8 antibody
    • UCP 2 antibody
    • ucp2 antibody
    • UCP2_HUMAN antibody
    • UCPH antibody
    • Uncoupling protein 2 antibody
    • Uncoupling protein 2 mitochondrial proton carrier antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse brain tissue labeling UCP2 with ab203244 at 1/400 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Bi J  et al. Irisin alleviates liver ischemia-reperfusion injury by inhibiting excessive mitochondrial fission, promoting mitochondrial biogenesis and decreasing oxidative stress. Redox Biol 20:296-306 (2019). Read more (PubMed: 30388684) »
  • Gao J  et al. Trilobatin Protects Against Oxidative Injury in Neuronal PC12 Cells Through Regulating Mitochondrial ROS Homeostasis Mediated by AMPK/Nrf2/Sirt3 Signaling Pathway. Front Mol Neurosci 11:267 (2018). Read more (PubMed: 30104959) »
See all 6 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Bos taurus Tissue sections (Digital cushion)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Sodium citrate
Permeabilization
No
Specification
Digital cushion
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Mar 16 2017

Application
Immunohistochemistry (Frozen sections)
Sample
Rat Tissue sections (Spinal Cord)
Permeabilization
Yes - 0.3% TritonX-100
Specification
Spinal Cord
Blocking step
BSA + Normal Goat Serum as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Dec 07 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up