Anti-UCP3 antibody (ab180643)
Key features and details
- Rabbit polyclonal to UCP3
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-UCP3 antibody
See all UCP3 primary antibodies -
Description
Rabbit polyclonal to UCP3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human UCP3 aa 1-110.
Sequence:MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAV QTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYD SVKQVYTPKG
Database link: P55916 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180643 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 34 kDa.
|
|
ICC/IF |
Use at an assay dependent concentration.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 34 kDa. |
ICC/IF
Use at an assay dependent concentration. |
Target
-
Function
UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance. -
Tissue specificity
Only in skeletal muscle and heart. Is more expressed in glycolytic than in oxidative skeletal muscles. -
Involvement in disease
Defects in UCP3 may be involved in obesity (OBESITY) [MIM:601665]. It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. -
Sequence similarities
Belongs to the mitochondrial carrier family.
Contains 3 Solcar repeats. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 7352 Human
- Entrez Gene: 22229 Mouse
- Omim: 602044 Human
- SwissProt: P55916 Human
- SwissProt: P56501 Mouse
- Unigene: 101337 Human
- Unigene: 621879 Human
- Unigene: 6254 Mouse
-
Form
UCP3 is preferentially expressed in muscle -
Alternative names
- Mitochondrial uncoupling protein 3 antibody
- SLC25A9 antibody
- Solute carrier family 25 member 9 antibody
see all
Images
-
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180643. Blue DAPI for nuclear staining.
-
All lanes : Anti-UCP3 antibody (ab180643) at 1/500 dilution
Lane 1 : mouse testis cell line extract
Lane 2 : mouse liver cell line extract
Lane 3 : mouse lung cell line extract
Predicted band size: 34 kDa
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (4)
ab180643 has been referenced in 4 publications.
- Osorio-Conles Ó et al. Positive Effects of a Mediterranean Diet Supplemented with Almonds on Female Adipose Tissue Biology in Severe Obesity. Nutrients 14:N/A (2022). PubMed: 35807797
- Bai Y et al. Protective Effect of Jiang Tang Xiao Ke Granules against Skeletal Muscle IR via Activation of the AMPK/SIRT1/PGC-1a Signaling Pathway. Oxid Med Cell Longev 2021:5566053 (2021). PubMed: 34326919
- Perelló-Amorós M et al. Mitochondrial Adaptation to Diet and Swimming Activity in Gilthead Seabream: Improved Nutritional Efficiency. Front Physiol 12:678985 (2021). PubMed: 34220544
- Sousa Fialho MDL et al. Activation of HIF1α Rescues the Hypoxic Response and Reverses Metabolic Dysfunction in the Diabetic Heart. Diabetes 70:2518-2531 (2021). PubMed: 34526367