Overview

  • Product name

  • Description

    Rabbit polyclonal to UFSP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human UFSP2 aa 63-343.
    Sequence:

    WPSSDINTIPGELTDASACKNILRFIQFEPEEDIKRKFMRKKDKKLSDMH QIVNIDLMLEMSTSLAAVTPIIERESGGHHYVNMTLPVDAVISVAPEETW GKVRKLLVDAIHNQLTDMEKCILKYMKGTSIVVPEPLHFLLPGKKNLVTI SYPSGIPDGQLQAYRKELHDLFNLPHDRPYFKRSNAYHFPDEPYKDGYIR NPHTYLNPPNMETGMIYVVQGIYGYHHYMQDRIDDNGWGCAYRSLQTICS WFKHQGYTERSIPTHREIQQALVDAGDKPAT


    Database link: Q9NUQ7

  • Positive control

    • WB: HepG2 and NIH/3T3 whole cell lysates; Mouse kidney lysate. IHC-P: Human kidney tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 53 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Thiol protease which recognizes and hydrolyzes the peptide bond at the C-terminal Gly of UFM1, a ubiquitin-like modifier protein bound to a number of target proteins. Does not hydrolyze SUMO1 or ISG15 ubiquitin-like proteins. Through TRIP4 deufmylation may regulate intracellular nuclear receptors transactivation and thereby regulate cell proliferation and differentiation.
  • Involvement in disease

    Beukes familial hip dysplasia
  • Sequence similarities

    Belongs to the peptidase C78 family.
  • Cellular localization

    Cytoplasm. Endoplasmic reticulum. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • C4orf20 antibody
    • Chromosome 4 open reading frame 20 antibody
    • FLJ11200 antibody
    • Ufm1 specific protease 2 antibody
    • UFM1-specific peptidase 2 antibody
    • Ufm1-specific protease 2 antibody
    • UfSP2 antibody
    • UFSP2_HUMAN antibody
    see all

Images

  • All lanes : Anti-UFSP2 antibody (ab236790) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : NIH/3T3 (mouse embyro fibroblast cell line) whole cell lysate
    Lane 3 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 53 kDa

  • Paraffin-embedded human kidney tissue stained for UFSP2 using ab236780 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for UFSP2 (green) using ab236790 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up