Overview

  • Product name

  • Description

    Rabbit polyclonal to UGGT/UGT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human UGGT/UGT1 aa 1221-1536. (Expressed in E.coli).
    Sequence:

    LSDGTSENESGFWDSFKWGFTGQKTEEVKQDKDDIINIFSVASGHLYERF LRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYK WPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKEL RDFNLDGAPYGYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVV DLKKFRKIAAGDRLRGQYQGLSQDPNSLSNLDQDLPNNMIHQVPIKSLPQ EWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEI KQLQIRFQKEKETGAL


    Database link: Q9NYU2

  • Positive control

    • IHC-P: Human skeletal muscle tissue. WB: Jurkat and HepG2 cell lysates; Pig cerebrum lysate; Recombinant human UGGT/UGT1 protein.
  • General notes

     This product was previously labelled as UGGT

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    ab233187 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 177 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Recognizes glycoproteins with minor folding defects. Reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognized by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.
  • Tissue specificity

    Higher levels in pancreas, skeletal muscle, kidney, and brain. Low levels in lung and heart.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 8 family.
  • Domain

    The N-terminal non-catalytic domain is assumed to mediate recognition of proteins with partial folding defects.
  • Cellular localization

    Endoplasmic reticulum lumen. Endoplasmic reticulum-Golgi intermediate compartment.
  • Information by UniProt
  • Database links

  • Alternative names

    • GT antibody
    • HUGT1 antibody
    • UDP glucose glycoprotein glucosyltransferase 1 antibody
    • UDP Glucose Glycoprotein Glucosyltransferase antibody
    • UDP--Glc:glycoprotein glucosyltransferase antibody
    • UDP-glucose ceramide glucosyltransferase-like 1 antibody
    • UDP-glucose:glycoprotein glucosyltransferase 1 antibody
    • UGCGL1 antibody
    • UGGG1 antibody
    • UGGG1_HUMAN antibody
    • UGGT antibody
    • Uggt1 antibody
    • UGT1 antibody
    • UGTR antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for UGGT/UGT1 using ab233187 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-UGGT/UGT1 antibody (ab233187) at 3 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 177 kDa

  • Anti-UGGT/UGT1 antibody (ab233187) at 3 µg/ml + Pig cerebrum lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 177 kDa

  • Anti-UGGT/UGT1 antibody (ab233187) at 3 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 177 kDa

  • Anti-UGGT/UGT1 antibody (ab233187) at 2 µg/ml + Recombinant human UGGT/UGT1 protein

    Predicted band size: 177 kDa

References

ab233187 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up