Overview

  • Product name

    Anti-UGT1A10 antibody
  • Description

    Mouse polyclonal to UGT1A10
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human UGT1A10 aa 187-289. (NP_061948).
    Sequence:

    LSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLFCQYLFRNALEIASEILQ TPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPME FEA


    Database link: Q9HAW8

  • Positive control

    • A431 cell lysate; Recombinant Human UGT1A10 protein (immunogen)

Properties

Applications

Our Abpromise guarantee covers the use of ab194474 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 60 kDa.

Target

  • Relevance

    The UGT enzymes comprise a superfamily of integral membrane proteins of the endoplasmic reticulum that have been subdivided into two families, UGT1 and UGT2, based on the evolutionary divergence of their genes. The enzymes of the UGT1A family play an important role in the metabolism of dietary constituents, phenols, and therapeutic drugs, and also the glucuronidation of bilirubin and iodothyronines. The enzymes of the UGT2B family are involved in the metabolism of bile acids, phenol derivatives, catecholestrogens and steroids. Although it is widely recognized that the liver is the major site of glucuronidation, it is now clear that UGT enzymes are also found in extra-hepatic tissues.
  • Cellular localization

    Microsome
  • Database links

  • Alternative names

    • GNT1 antibody
    • UDP glucuronosyltransferase 1 10 antibody
    • UDP glucuronosyltransferase 1 family polypeptide A10 antibody
    • UDP glucuronosyltransferase 1 J antibody
    • UDP glucuronosyltransferase 1A10 antibody
    • UDP glycosyltransferase antibody
    • UDPGT antibody
    • UDPGT 1 10 antibody
    • UGT 1J antibody
    • UGT1 antibody
    • UGT1 10 antibody
    • UGT1.10 antibody
    • UGT1J antibody
    see all

Images

  • Anti-UGT1A10 antibody (ab194474) at 1/500 dilution + A431 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 60 kDa

  • Anti-UGT1A10 antibody (ab194474) at 1/1000 dilution + Recombinant Human UGT1A10 protein (immunogen) at 0.2 µg

    Developed using the ECL technique.

    Predicted band size: 60 kDa



    Predicted MWt of immunogen: 37.44 KDa.

References

ab194474 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Human Cell lysate - whole cell (breast adenocarcinoma, colorectal adenocarcinoma)
Gel Running Conditions
Reduced Denaturing (10% resolving, 5% stacking gel)
Loading amount
40 µg
Specification
breast adenocarcinoma, colorectal adenocarcinoma
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Ms. Joanna Polewska

Verified customer

Submitted Dec 09 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up