Overview

  • Product name

  • Description

    Rabbit polyclonal to UGT2B7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human UGT2B7 aa 237-382.
    Sequence:

    SEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAK PLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVL WRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYE


    Database link: P16662

  • Positive control

    • IHC-P: Human colon cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/200 - 1/500.

Target

  • Function

    UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
    Its unique specificity for 3,4-catechol estrogens and estriol suggests it may play an important role in regulating the level and activity of these potent and active estrogen metabolites.
  • Sequence similarities

    Belongs to the UDP-glycosyltransferase family.
  • Cellular localization

    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • UDP glucuronosyltransferase 2 family, member B7 antibody
    • 3 4 catechol estrogen specific antibody
    • 3 antibody
    • 3,4 catechol estrogen specific UDPGT antibody
    • 4-catechol estrogen-specific UDPGT antibody
    • UD2B7_HUMAN antibody
    • UDP glucuronosyltransferase 2 family, polypeptide B7 antibody
    • UDP glucuronosyltransferase 2 family polypeptide B7 antibody
    • UDP glucuronosyltransferase 2 family, member B9 antibody
    • UDP glucuronosyltransferase 2B7 antibody
    • UDP glucuronosyltransferase2 family, polypeptide B7 antibody
    • UDP glucuronyltransferase family 2 beta 7 antibody
    • UDP glycosyltransferase 2 family polypeptide B7 antibody
    • UDP-glucuronosyltransferase 2B7 antibody
    • UDP-glucuronosyltransferase 2B9 antibody
    • UDPGT antibody
    • UDPGT 2B7 antibody
    • UDPGT 2B9 antibody
    • UDPGT2B7 antibody
    • UDPGTh 2 antibody
    • UDPGTh-2 antibody
    • UDPGTh2 antibody
    • UGT2B7 antibody
    • UGT2B9 antibody
    • UGTB2B9 antibody
    • uridine diphosphate glycosyltransferase 2 family, member B7 antibody
    • uridine diphosphate glycosyltransferase 2 family, member B9 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for UGT2B7 using ab235988 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for UGT2B7 (green) using ab235988 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). Counter-stained with DAPI (blue).

References

ab235988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up