Overview

  • Product name

  • Description

    Rabbit polyclonal to ULBP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human ULBP1 aa 26-216. Full length chain without signal peptide, without propeptide.
    Sequence:

    GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFA SLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARM SCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKN RDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG


    Database link: Q9BZM6

  • Positive control

    • IHC-P: Human testis and liver tissue. ICC/IF: HEK-293 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity 95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/20 - 1/200.

Target

  • Function

    Ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.
  • Tissue specificity

    Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver.
  • Sequence similarities

    Belongs to the MHC class I family.
  • Cellular localization

    Cell membrane. Endoplasmic reticulum. Detected intracellularly in the endoplasmic reticulum of CMV-infected fibroblasts.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alcan beta antibody
    • ALCAN-beta antibody
    • N2DL-1 antibody
    • N2DL1 antibody
    • N2DL1_HUMAN antibody
    • NKG2D ligand 1 antibody
    • NKG2D ligand 1 precursor antibody
    • NKG2DL1 antibody
    • RAET1I antibody
    • Retinoic acid early transcript 1I antibody
    • UL16 antibody
    • UL16 binding protein 1 antibody
    • UL16-binding protein 1 antibody
    • ULBP1 antibody
    see all

Images

  • HEK-293 (human epithelial cell line from embryonic kidney) cells stained for ULBP1 using ab238331 at a dilution of 1/33 in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

  • Paraffin-embedded human testis tissue stained for ULBP1 with ab238331 at a 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human liver tissue stained for ULBP1 with ab238331 at a 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab238331 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238331.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up