Overview

  • Product name

  • Description

    Rabbit polyclonal to ULK4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ULK4 aa 1-290.
    Sequence:

    MENFILYEEIGRGSKTVVYKGRRKGTINFVAILCTDKCKRPEITNWVRLT REIKHKNIVTFHEWYETSNHLWLVVELCTGGSLKTVIAQDENLPEDVVRE FGIDLISGLHHLHKLGILFCDISPRKILLEGPGTLKFSNFCLAKVEGENL EEFFALVAAEEGGGDNGENVLKKSMKSRVKGSPVYTAPEVVRGADFSISS DLWSLGCLLYEMFSGKPPFFSESISELTEKILCEDPLPPIPKDSSRPKAS SDFINLLDGLLQRDPQKRLTWTRLLQHSFWKKAFAGADQE


    Database link: Q96C45

  • Positive control

    • IHC-P: Human testis and skin tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. APG1/unc-51/ULK1 subfamily.
    Contains 5 HEAT repeats.
    Contains 1 protein kinase domain.
  • Domain

    The protein kinase domain is predicted to be catalytically inactive.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp 434E1822 antibody
    • DKFZp434E1822 antibody
    • FAM 7 C 1 antibody
    • FAM7C1 antibody
    • FLJ 20574 antibody
    • FLJ20574 antibody
    • REC 01035 antibody
    • REC01035 antibody
    • Serine/threonine-protein kinase ULK4 antibody
    • ULK 4 antibody
    • ULK4 antibody
    • ULK4_HUMAN antibody
    • Unc 51 like kinase 4 antibody
    • Unc 51 like kinase 4 (C. elegans) antibody
    • Unc-51-like kinase 4 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for ULK4 using ab230041 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for ULK4 using ab230041 at 1/100 dilution in immunohistochemical analysis.

References

ab230041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up