Overview

  • Product name
  • Description
    Mouse polyclonal to UMOD
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human UMOD aa 1-611. (UniProt ID: P07911-3; AAH35975)
    Sequence:

    MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTC TCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRL SPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCEC SPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLR GWYRPHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAP PECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLL EHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVS VVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPL DMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTL STEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPH TRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCK PTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPL LLSATLTLTFQ

  • Positive control
    • UMOD transfected 293T cell lysate; Human kidney tissue; HeLa cells
  • General notes

    Previously labelled as Uromucoid. 

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab167678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa.
IHC-P Use a concentration of 3 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Not known. May play a role in regulating the circulating activity of cytokines as it binds to IL-1, IL-2 and TNF with high affinity.
  • Tissue specificity
    Synthesized by kidney. Most abundant protein in normal human urine.
  • Involvement in disease
    Defects in UMOD are the cause of familial juvenile hyperuricemic nephropathy type 1 (HNFJ1) [MIM:162000]. HNFJ1 is a renal disease characterized by juvenil onset of hyperuricemia, polyuria, progressive renal failure, and gout. The disease is associated with interstitial pathological changes resulting in fibrosis.
    Defects in UMOD are the cause of medullary cystic kidney disease type 2 (MCKD2) [MIM:603860]. MCKD2 is a form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade.
    Defects in UMOD are the cause of glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI) [MIM:609886]. GCKDHI is a renal disorder characterized by a cystic dilation of Bowman space, a collapse of glomerular tuft, and hyperuricemia due to low fractional excretion of uric acid and severe impairment of urine concentrating ability.
  • Sequence similarities
    Contains 3 EGF-like domains.
    Contains 1 ZP domain.
  • Cellular localization
    Cell membrane. Secreted. Secreted after cleavage in the urine.
  • Information by UniProt
  • Database links
  • Alternative names
    • ADMCKD2 antibody
    • FJHN antibody
    • HNFJ antibody
    • HNFJ1 antibody
    • MCKD2 antibody
    • medullary cystic kidney disease 2 (autosomal dominant) antibody
    • Tamm Horsfall glycoprotein antibody
    • Tamm Horsfall urinary glycoprotein antibody
    • Tamm-Horsfall urinary glycoprotein antibody
    • THGP antibody
    • THP antibody
    • Umod antibody
    • Urehd1 antibody
    • urehr4 antibody
    • UROM_HUMAN antibody
    • uromodulin (uromucoid, Tamm-Horsfall glycoprotein) antibody
    • Uromodulin antibody
    • Uromodulin, secreted form antibody
    • Uromucoid antibody
    see all

Images

  • All lanes : Anti-UMOD antibody (ab167678) at 1 µg/ml

    Lane 1 : UMOD transfected 293T cell lysate
    Lane 2 : Non-transfected transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 67 kDa

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human kidney tissue labeling UMOD with ab167678 at 3 µg/ml.

  • Immunofluorescence analysis of HeLa cells, labeling UMOD with ab167678 at 10 µg/ml.

References

ab167678 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167678.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up