Anti-UMOD antibody (ab167678)
Key features and details
- Mouse polyclonal to UMOD
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-UMOD antibody
See all UMOD primary antibodies -
Description
Mouse polyclonal to UMOD -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Full length protein corresponding to Human UMOD aa 1-611. (UniProt ID: P07911-3; AAH35975)
Sequence:MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTC TCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRL SPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCEC SPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLR GWYRPHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAP PECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLL EHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVS VVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPL DMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTL STEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPH TRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCK PTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPL LLSATLTLTFQ
-
Positive control
- UMOD transfected 293T cell lysate; Human kidney tissue; HeLa cells
-
General notes
Previously labelled as Uromucoid.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab167678 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa. | |
IHC-P | Use a concentration of 3 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 10 µg/ml. |
Target
-
Function
Not known. May play a role in regulating the circulating activity of cytokines as it binds to IL-1, IL-2 and TNF with high affinity. -
Tissue specificity
Synthesized by kidney. Most abundant protein in normal human urine. -
Involvement in disease
Defects in UMOD are the cause of familial juvenile hyperuricemic nephropathy type 1 (HNFJ1) [MIM:162000]. HNFJ1 is a renal disease characterized by juvenil onset of hyperuricemia, polyuria, progressive renal failure, and gout. The disease is associated with interstitial pathological changes resulting in fibrosis.
Defects in UMOD are the cause of medullary cystic kidney disease type 2 (MCKD2) [MIM:603860]. MCKD2 is a form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade.
Defects in UMOD are the cause of glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI) [MIM:609886]. GCKDHI is a renal disorder characterized by a cystic dilation of Bowman space, a collapse of glomerular tuft, and hyperuricemia due to low fractional excretion of uric acid and severe impairment of urine concentrating ability. -
Sequence similarities
Contains 3 EGF-like domains.
Contains 1 ZP domain. -
Cellular localization
Cell membrane. Secreted. Secreted after cleavage in the urine. - Information by UniProt
-
Database links
- Entrez Gene: 7369 Human
- Omim: 191845 Human
- SwissProt: P07911 Human
- Unigene: 654425 Human
-
Alternative names
- ADMCKD2 antibody
- FJHN antibody
- HNFJ antibody
see all
Images
-
Immunofluorescence analysis of HeLa cells, labeling UMOD with ab167678 at 10 µg/ml.
-
All lanes : Anti-UMOD antibody (ab167678) at 1 µg/ml
Lane 1 : UMOD transfected 293T cell lysate
Lane 2 : Non-transfected transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Developed using the ECL technique.
Predicted band size: 67 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UMOD antibody (ab167678)
Immunohistochemical analysis of formalin fixed, paraffin embedded Human kidney tissue labeling UMOD with ab167678 at 3 µg/ml.
Protocols
Datasheets and documents
References (0)
ab167678 has not yet been referenced specifically in any publications.