For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    umod-antibody-ab167678.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Other Antibodies Other Antibodies
Share by email

Anti-UMOD antibody (ab167678)

  • Datasheet
Reviews (1) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-UMOD antibody (ab167678)
  • Western blot - Anti-UMOD antibody (ab167678)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UMOD antibody (ab167678)

Key features and details

  • Mouse polyclonal to UMOD
  • Suitable for: WB, IHC-P, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)
Isotype
Mouse IgG - Isotype Control (ab37355)
Protein
Recombinant VZV gE protein (ab43050)

View more associated products

Overview

  • Product name

    Anti-UMOD antibody
    See all UMOD primary antibodies
  • Description

    Mouse polyclonal to UMOD
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human UMOD aa 1-611. (UniProt ID: P07911-3; AAH35975)
    Sequence:

    MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTC TCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRL SPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCEC SPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLR GWYRPHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAP PECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLL EHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVS VVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPL DMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTL STEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPH TRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCK PTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPL LLSATLTLTFQ

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • UMOD transfected 293T cell lysate; Human kidney tissue; HeLa cells
  • General notes

    Previously labelled as Uromucoid. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.4
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Other Antibodies
    • Other Antibodies

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG - Isotype Control (ab37355)

Applications

Our Abpromise guarantee covers the use of ab167678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa.
IHC-P Use a concentration of 3 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function

    Not known. May play a role in regulating the circulating activity of cytokines as it binds to IL-1, IL-2 and TNF with high affinity.
  • Tissue specificity

    Synthesized by kidney. Most abundant protein in normal human urine.
  • Involvement in disease

    Defects in UMOD are the cause of familial juvenile hyperuricemic nephropathy type 1 (HNFJ1) [MIM:162000]. HNFJ1 is a renal disease characterized by juvenil onset of hyperuricemia, polyuria, progressive renal failure, and gout. The disease is associated with interstitial pathological changes resulting in fibrosis.
    Defects in UMOD are the cause of medullary cystic kidney disease type 2 (MCKD2) [MIM:603860]. MCKD2 is a form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade.
    Defects in UMOD are the cause of glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI) [MIM:609886]. GCKDHI is a renal disorder characterized by a cystic dilation of Bowman space, a collapse of glomerular tuft, and hyperuricemia due to low fractional excretion of uric acid and severe impairment of urine concentrating ability.
  • Sequence similarities

    Contains 3 EGF-like domains.
    Contains 1 ZP domain.
  • Cellular localization

    Cell membrane. Secreted. Secreted after cleavage in the urine.
  • Target information above from: UniProt accession P07911 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 7369 Human
    • Omim: 191845 Human
    • SwissProt: P07911 Human
    • Unigene: 654425 Human
    • Alternative names

      • ADMCKD2 antibody
      • FJHN antibody
      • HNFJ antibody
      • HNFJ1 antibody
      • MCKD2 antibody
      • medullary cystic kidney disease 2 (autosomal dominant) antibody
      • Tamm Horsfall glycoprotein antibody
      • Tamm Horsfall urinary glycoprotein antibody
      • Tamm-Horsfall urinary glycoprotein antibody
      • THGP antibody
      • THP antibody
      • Umod antibody
      • Urehd1 antibody
      • urehr4 antibody
      • UROM_HUMAN antibody
      • uromodulin (uromucoid, Tamm-Horsfall glycoprotein) antibody
      • Uromodulin antibody
      • Uromodulin, secreted form antibody
      • Uromucoid antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-UMOD antibody (ab167678)
      Immunocytochemistry/ Immunofluorescence - Anti-UMOD antibody (ab167678)

      Immunofluorescence analysis of HeLa cells, labeling UMOD with ab167678 at 10 µg/ml.

    • Western blot - Anti-UMOD antibody (ab167678)
      Western blot - Anti-UMOD antibody (ab167678)
      All lanes : Anti-UMOD antibody (ab167678) at 1 µg/ml

      Lane 1 : UMOD transfected 293T cell lysate
      Lane 2 : Non-transfected transfected 293T cell lysate

      Lysates/proteins at 15 µl per lane.

      Developed using the ECL technique.

      Predicted band size: 67 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UMOD antibody (ab167678)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UMOD antibody (ab167678)

      Immunohistochemical analysis of formalin fixed, paraffin embedded Human kidney tissue labeling UMOD with ab167678 at 3 µg/ml.

    Protocols

    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab167678? Please let us know so that we can cite the reference in this datasheet.

    ab167678 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-UMOD antibody

    Poor
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample
    Pig Tissue sections (Kidney)
    Antigen retrieval step
    Heat mediated - Buffer/Enzyme Used: Citrate Buffer, pH 6.0
    Permeabilization
    Yes - 0.05% Tween in PBS for 10 minutes
    Specification
    Kidney
    Blocking step
    Serum as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 23°C
    Fixative
    Formaldehyde
    Read More

    Abcam user community

    Verified customer

    Submitted Aug 02 2019

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.