Anti-UMOD antibody (ab167678)
- Datasheet
- References
- Protocols
Overview
-
Product nameAnti-UMOD antibody
See all UMOD primary antibodies -
DescriptionMouse polyclonal to UMOD
-
Host speciesMouse
-
Tested applicationsSuitable for: WB, IHC-P, ICC/IFmore details
-
Species reactivityReacts with: Human
-
Immunogen
Full length protein corresponding to Human UMOD aa 1-611. (UniProt ID: P07911-3; AAH35975)
Sequence:MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTC TCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRL SPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCEC SPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLR GWYRPHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAP PECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLL EHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVS VVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPL DMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTL STEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPH TRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCK PTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPL LLSATLTLTFQ
-
Positive control
- UMOD transfected 293T cell lysate; Human kidney tissue; HeLa cells
-
General notes
Previously labelled as Uromucoid.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
-
Storage bufferpH: 7.20
Constituent: 99% PBS -
Concentration information loading... -
PurityProtein A purified
-
ClonalityPolyclonal
-
IsotypeIgG
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab167678 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa. | |
| IHC-P | Use a concentration of 3 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 10 µg/ml. |
Target
-
FunctionNot known. May play a role in regulating the circulating activity of cytokines as it binds to IL-1, IL-2 and TNF with high affinity.
-
Tissue specificitySynthesized by kidney. Most abundant protein in normal human urine.
-
Involvement in diseaseDefects in UMOD are the cause of familial juvenile hyperuricemic nephropathy type 1 (HNFJ1) [MIM:162000]. HNFJ1 is a renal disease characterized by juvenil onset of hyperuricemia, polyuria, progressive renal failure, and gout. The disease is associated with interstitial pathological changes resulting in fibrosis.
Defects in UMOD are the cause of medullary cystic kidney disease type 2 (MCKD2) [MIM:603860]. MCKD2 is a form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade.
Defects in UMOD are the cause of glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI) [MIM:609886]. GCKDHI is a renal disorder characterized by a cystic dilation of Bowman space, a collapse of glomerular tuft, and hyperuricemia due to low fractional excretion of uric acid and severe impairment of urine concentrating ability. -
Sequence similaritiesContains 3 EGF-like domains.
Contains 1 ZP domain. -
Cellular localizationCell membrane. Secreted. Secreted after cleavage in the urine.
- Information by UniProt
-
Database links
- Entrez Gene: 7369 Human
- Omim: 191845 Human
- SwissProt: P07911 Human
- Unigene: 654425 Human
-
Alternative names
- ADMCKD2 antibody
- FJHN antibody
- HNFJ antibody
see all
Images
-
Western blot - Anti-UMOD antibody (ab167678)All lanes : Anti-UMOD antibody (ab167678) at 1 µg/ml
Lane 1 : UMOD transfected 293T cell lysate
Lane 2 : Non-transfected transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Developed using the ECL technique.
Predicted band size: 67 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UMOD antibody (ab167678)Immunohistochemical analysis of formalin fixed, paraffin embedded Human kidney tissue labeling UMOD with ab167678 at 3 µg/ml.
-
Immunocytochemistry/ Immunofluorescence - Anti-UMOD antibody (ab167678)Immunofluorescence analysis of HeLa cells, labeling UMOD with ab167678 at 10 µg/ml.
Datasheets and documents
Protocols
References
ab167678 has not yet been referenced specifically in any publications.
