Overview

  • Product name

  • Description

    Rabbit polyclonal to UMOD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Mouse UMOD aa 120-170 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    HALATCVNTEGDYLCVCPEGFTGDGWYCECSPGSCEPGLDCLPQGPDGKL V


    Database link: Q91X17

  • Positive control

    • Human kidney lysate.
  • General notes

    Previously labelled as Uromucoid. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab216887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Detects a band of approximately 65 kDa (predicted molecular weight: 71 kDa).

Target

  • Function

    Not known. May play a role in regulating the circulating activity of cytokines as it binds to IL-1, IL-2 and TNF with high affinity.
  • Tissue specificity

    Synthesized by kidney. Most abundant protein in normal human urine.
  • Involvement in disease

    Defects in UMOD are the cause of familial juvenile hyperuricemic nephropathy type 1 (HNFJ1) [MIM:162000]. HNFJ1 is a renal disease characterized by juvenil onset of hyperuricemia, polyuria, progressive renal failure, and gout. The disease is associated with interstitial pathological changes resulting in fibrosis.
    Defects in UMOD are the cause of medullary cystic kidney disease type 2 (MCKD2) [MIM:603860]. MCKD2 is a form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade.
    Defects in UMOD are the cause of glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI) [MIM:609886]. GCKDHI is a renal disorder characterized by a cystic dilation of Bowman space, a collapse of glomerular tuft, and hyperuricemia due to low fractional excretion of uric acid and severe impairment of urine concentrating ability.
  • Sequence similarities

    Contains 3 EGF-like domains.
    Contains 1 ZP domain.
  • Cellular localization

    Cell membrane. Secreted. Secreted after cleavage in the urine.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADMCKD2 antibody
    • FJHN antibody
    • HNFJ antibody
    • HNFJ1 antibody
    • MCKD2 antibody
    • medullary cystic kidney disease 2 (autosomal dominant) antibody
    • Tamm Horsfall glycoprotein antibody
    • Tamm Horsfall urinary glycoprotein antibody
    • Tamm-Horsfall urinary glycoprotein antibody
    • THGP antibody
    • THP antibody
    • Umod antibody
    • Urehd1 antibody
    • urehr4 antibody
    • UROM_HUMAN antibody
    • uromodulin (uromucoid, Tamm-Horsfall glycoprotein) antibody
    • Uromodulin antibody
    • Uromodulin, secreted form antibody
    • Uromucoid antibody
    see all

Images

  • All lanes : Anti-UMOD antibody (ab216887) at 1/200 dilution

    All lanes : Human kidney lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), AP at 1/3000 dilution

    Developed using the ECL technique.

    Predicted band size: 71 kDa

References

ab216887 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216887.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up