Overview

  • Product name

  • Description

    Rabbit polyclonal to UMOD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Dog, Orangutan
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human UMOD aa 334-589. N-terminal tag. (Expressed in E.coli).
    Sequence:

    ECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTP ARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPLDMKV SLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEA FLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDS TIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCS GTRFRS


    Database link: P07911

  • Positive control

    • WB: Recombinant human UMOD protein, human urine and human serum.
  • General notes

    Previously labelled as Uromucoid. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 70 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Not known. May play a role in regulating the circulating activity of cytokines as it binds to IL-1, IL-2 and TNF with high affinity.
  • Tissue specificity

    Synthesized by kidney. Most abundant protein in normal human urine.
  • Involvement in disease

    Defects in UMOD are the cause of familial juvenile hyperuricemic nephropathy type 1 (HNFJ1) [MIM:162000]. HNFJ1 is a renal disease characterized by juvenil onset of hyperuricemia, polyuria, progressive renal failure, and gout. The disease is associated with interstitial pathological changes resulting in fibrosis.
    Defects in UMOD are the cause of medullary cystic kidney disease type 2 (MCKD2) [MIM:603860]. MCKD2 is a form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade.
    Defects in UMOD are the cause of glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI) [MIM:609886]. GCKDHI is a renal disorder characterized by a cystic dilation of Bowman space, a collapse of glomerular tuft, and hyperuricemia due to low fractional excretion of uric acid and severe impairment of urine concentrating ability.
  • Sequence similarities

    Contains 3 EGF-like domains.
    Contains 1 ZP domain.
  • Cellular localization

    Cell membrane. Secreted. Secreted after cleavage in the urine.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADMCKD2 antibody
    • FJHN antibody
    • HNFJ antibody
    • HNFJ1 antibody
    • MCKD2 antibody
    • medullary cystic kidney disease 2 (autosomal dominant) antibody
    • Tamm Horsfall glycoprotein antibody
    • Tamm Horsfall urinary glycoprotein antibody
    • Tamm-Horsfall urinary glycoprotein antibody
    • THGP antibody
    • THP antibody
    • Umod antibody
    • Urehd1 antibody
    • urehr4 antibody
    • UROM_HUMAN antibody
    • uromodulin (uromucoid, Tamm-Horsfall glycoprotein) antibody
    • Uromodulin antibody
    • Uromodulin, secreted form antibody
    • Uromucoid antibody
    see all

Images

  • Anti-UMOD antibody (ab233262) at 2 µg/ml + Recombinant human UMOD protein

    Developed using the ECL technique.

    Predicted band size: 70 kDa

  • All lanes : Anti-UMOD antibody (ab233262) at 2 µg/ml

    Lane 1 : Human urine
    Lane 2 : Human serum

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 70 kDa

References

ab233262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up