Overview

  • Product name

  • Description

    Rabbit polyclonal to UNC45B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human UNC45B aa 602-710.
    Sequence:

    SKQHVPEEHPKDKKDFIDMRVKRLLKAGVISALACMVKADSAILTDQTKE LLARVFLALCDNPKDRGTIVAQGGGKALIPLALEGTDVGKVKAAHALAKI AAVSNPDIA


    Database link: Q8IWX7

  • Positive control

    • IHC-P: Human skeletal muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234730 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain. Plays a role in sarcomere formation during muscle cell development.
  • Sequence similarities

    Contains 3 ARM repeats.
    Contains 3 TPR repeats.
  • Cellular localization

    Cytoplasm > cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cardiomyopathy associated 4 antibody
    • CMYA4 antibody
    • FLJ38610 antibody
    • MGC119540 antibody
    • MGC119541 antibody
    • OTTHUMP00000163855 antibody
    • Protein unc 45 homolog B antibody
    • Protein unc-45 homolog B antibody
    • SMUNC45 antibody
    • Striated muscle UNC45 antibody
    • UN45B_HUMAN antibody
    • Unc 45 homolog B (C. elegans) antibody
    • Unc 45 homolog B antibody
    • UNC 45B antibody
    • UNC-45B antibody
    • UNC45 antibody
    • UNC45B antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for UNC45B with ab234730 at 1/100 dilution in immunohistochemical analysis.

References

ab234730 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234730.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up