Overview

  • Product name

  • Description

    Rabbit polyclonal to Unc5a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Unc5a aa 687-765.
    Sequence:

    VSPSTSDLACKLWVWQVEGDGQSFSINFNITKDTRFAELLALESEAGVPA LVGPSAFKIPFLIRQKIIS


    Database link: Q6ZN44

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Receptor for netrin required for axon guidance. Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand.
  • Sequence similarities

    Belongs to the unc-5 family.
    Contains 1 death domain.
    Contains 1 Ig-like (immunoglobulin-like) domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 TSP type-1 domain.
    Contains 1 ZU5 domain.
  • Domain

    The ZU5 domain mediates the interaction with MAGED1, which participates in the induction of apoptosis.
  • Post-translational
    modifications

    Phosphorylated on cytoplasmic tyrosine residues. Phosphorylated by PKC in vitro.
    Proteolytically cleaved by caspases during apoptosis. The cleavage does not take place when the receptor is associated with netrin ligand. Its cleavage by caspases is required to induce apoptosis.
  • Cellular localization

    Cell membrane. The interaction with PRKCABP regulates its surface expression and leads to its removal from surface of neurons and growth cones.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ16449 antibody
    • KIAA1976 antibody
    • Netrin receptor UNC 5A antibody
    • Netrin receptor UNC5A antibody
    • Netrin receptor Unc5h1 antibody
    • Protein unc-5 homolog 1 antibody
    • Protein unc-5 homolog A antibody
    • Unc 5 homolog 1 antibody
    • Unc 5 homolog A antibody
    • Unc 5 netrin receptor A antibody
    • Unc 5a antibody
    • Unc5 a antibody
    • Unc5 homolog 1 antibody
    • Unc5 homolog A antibody
    • Unc5a antibody
    • UNC5A_HUMAN antibody
    • Unc5h1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Unc5a (green) using ab222205 at 4 µg/ml in ICC/IF.

References

ab222205 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Human Cell lysate - whole cell (Cell lines : Hep3B,Huh7,PHH(Primary Human Hepatocy)
Gel Running Conditions
Reduced Denaturing (Precast 4-20%)
Loading amount
80 µg
Specification
Cell lines : Hep3B,Huh7,PHH(Primary Human Hepatocy
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C

Abcam user community

Verified customer

Submitted Aug 23 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up