Overview

  • Product name

  • Description

    Rabbit polyclonal to UNC5C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human UNC5C aa 121-170 (internal sequence). The exact sequence is proprietary.
    Sequence:

    EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFE


    Database link: O95185-2

  • Positive control

    • 293T whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab178823 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 66 kDa.

Target

  • Function

    Receptor for netrin required for axon guidance. Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion. Also involved in corticospinal tract axon guidances independently of DCC. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand.
  • Tissue specificity

    Mainly expressed in brain. Also expressed in kidney. Not expressed in developing or adult lung.
  • Sequence similarities

    Belongs to the unc-5 family.
    Contains 1 death domain.
    Contains 1 Ig-like (immunoglobulin-like) domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 2 TSP type-1 domains.
    Contains 1 ZU5 domain.
  • Post-translational
    modifications

    Phosphorylated on different cytoplasmic tyrosine residues. Phosphorylation of Tyr-568 leads to an interaction with PTPN11 phosphatase, suggesting that its activity is regulated by phosphorylation/dephosphorylation. Tyrosine phosphorylation is netrin-dependent.
    Proteolytically cleaved by caspases during apoptosis. The cleavage does not take place when the receptor is associated with netrin ligand. Its cleavage by caspases is required to induce apoptosis.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • homolog of C. elegans transmembrane receptor Unc5 antibody
    • Netrin receptor UNC5C antibody
    • Protein unc 5 homolog C antibody
    • Protein unc-5 homolog 3 antibody
    • Protein unc-5 homolog C antibody
    • Unc 5 homolog 3 antibody
    • Unc 5 homolog C antibody
    • Unc5 (C.elegans homolog) c antibody
    • Unc5c antibody
    • UNC5C_HUMAN antibody
    • UNC5H3 antibody
    see all

Images

  • Anti-UNC5C antibody (ab178823) at 1 µg/ml + 293T whole cell lysate at 10 µg

    Predicted band size: 66 kDa

References

ab178823 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178823.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up