Overview

  • Product name

  • Description

    Rabbit polyclonal to UNC93B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human UNC93B1 aa 300-597.
    Sequence:

    MLLVLGLCGAAYRPTEEIDLRSVGWGNIFQLPFKHVRDYRLRHLVPFFIY SGFEVLFACTGIALGYGVCSVGLERLAYLLVAYSLGASAASLLGLLGLWL PRPVPLVAGAGVHLLLTFILFFWAPVPRVLQHSWILYVAAALWGVGSALN KTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFTVYLGSSLHMKAKLAV LLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYRYLEEDNSDE SDAEGEHGDGAEEEAPPAGPRPGPEPAGLGRRPCPYEQAQGGDGPEEQ


    Database link: Q9H1C4

  • Positive control

    • Human heart.
  • General notes

     This product was previously labelled as UNC93B

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 99% PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab208288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 4 µg/ml. Predicted molecular weight: 67 kDa.

Target

  • Relevance

    UNC93B is a protein with similarity to the C. elegans unc93 protein. The Unc93 protein is involved in the regulation or coordination of muscle contraction in the worm. Defects in UNC93B are associated with susceptibility to herpes simplex encephalitis (HSE) which is a rare complication of human herpesvirus 1 (HHV-1) infection.
  • Cellular localization

    Membrane; Multi pass membrane protein
  • Database links

  • Alternative names

    • hUNC93B1 antibody
    • IIAE1 antibody
    • Protein unc 93 homolog B1 antibody
    • Protein UNC 93B antibody
    • unc 93 homolog B1 antibody
    • unc 93 homolog B1 (C elegans) antibody
    • unc 93 related protein antibody
    • Unc 93B1 antibody
    • unc93 (C elegans) homolog B antibody
    • unc93 (C elegans) homolog B1 antibody
    • UNC93 antibody
    • UNC93B antibody
    • UNC93B1 antibody
    see all

Images

  • Anti-UNC93B1 antibody (ab208288) at 4 µg/ml + Human heart

    Predicted band size: 67 kDa

References

ab208288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up