Overview

  • Product name

  • Description

    Rabbit polyclonal to UNG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human UNG aa 1-313. (Expressed in E.coli).
    Sequence:

    MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKK APAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKK HLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVI LGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGD LSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLV FLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELL QKSGKKPIDWKEL


    Database link: P13051

  • Positive control

    • WB: Recombinant human UNG protein; Pig heart lysate. IHC-P: Human pancreas, cerebrum, glioma, liver, kidney and stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 35 kDa.

Target

  • Function

    Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.
  • Tissue specificity

    Isoform 1 is widely expressed with the highest expression in skeletal muscle, heart and testicles. Isoform 2 has the highest expression levels in tissues containing proliferating cells.
  • Involvement in disease

    Defects in UNG are a cause of immunodeficiency with hyper-IgM type 5 syndrome (HIGM5) [MIM:608106]. Hyper-IgM syndrome is a condition characterized by normal or increased serum IgM concentrations associated with low or absent serum IgG, IgA, and IgE concentrations. HIGM5 is associated with profound impairment in immunoglobulin (Ig) class-switch recombination (CSR) at a DNA precleavage step.
  • Sequence similarities

    Belongs to the uracil-DNA glycosylase family.
  • Post-translational
    modifications

    Isoform 1 is processed by cleavage of a transit peptide.
  • Cellular localization

    Mitochondrion and Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DGU antibody
    • DKFZp781L1143 antibody
    • HIGM 4 antibody
    • HIGM4 antibody
    • OTTHUMP00000240527 antibody
    • OTTHUMP00000240528 antibody
    • OTTHUMP00000240529 antibody
    • UDG antibody
    • UNG 1 antibody
    • UNG 15 antibody
    • ung antibody
    • UNG_HUMAN antibody
    • UNG1 antibody
    • UNG15 antibody
    • UNG2 antibody
    • Uracil DNA glycosylase 1 antibody
    • Uracil DNA glycosylase 2 antibody
    • Uracil DNA glycosylase antibody
    • Uracil-DNA glycosylase antibody
    see all

Images

  • Anti-UNG antibody (ab233206) at 2 µg/ml + Recombinant human UNG protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 35 kDa

  • Anti-UNG antibody (ab233206) at 2 µg/ml + Pig heart lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 35 kDa

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for UNG using ab233206 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for UNG using ab233206 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for UNG using ab233206 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for UNG using ab233206 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for UNG using ab233206 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for UNG using ab233206 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233206 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up