Overview

  • Product name

  • Description

    Rabbit polyclonal to UPB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human UPB1 aa 121-384. (Expressed in E.coli).
    Sequence:

    WTMPFAFCTREKLPWTEFAESAEDGPTTRFCQKLAKNHDMVVVSPILERD SEHGDVLWNTAVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPV FQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATIGALSESLWPI EARNAAIANHCFTCAINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVA APDSSRTPGLSRSRDGLLVAKLDLNLCQQVNDVWNFKMTGRYEMYARELA EAVKSNYSPTIVKE


    Database link: Q9UBR1

  • Positive control

    • WB: Recombinant human UPB1 protein; Pig and rat liver lysates. IHC-P: Human kidney, liver and liver cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 43 kDa.

Target

Images

  • Anti-UPB1 antibody (ab231329) at 1 µg/ml + Recombinant human UPB1 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 43 kDa

  • All lanes : Anti-UPB1 antibody (ab231329) at 1 µg/ml

    Lane 1 : Pig liver lysate
    Lane 2 : Rat liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 43 kDa

  • Paraffin-embedded human liver tissue stained for UPB1 using ab231329 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver cancer tissue stained for UPB1 using ab231329 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for UPB1 using ab231329 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up