Overview

  • Product name

  • Description

    Rabbit polyclonal to UQCRC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human UQCRC1 aa 148-252.
    Sequence:

    GDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPL AQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQ KHLGG


    Database link: P31930

  • Positive control

    • IHC-P: Human small intestine tissue. WB: HEK-293, NIH/3T3, NBT-II and PC-12 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab223746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 53 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
  • Sequence similarities

    Belongs to the peptidase M16 family. UQCRC1/QCR1 subfamily.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Complex III subunit 1 antibody
    • Core protein I antibody
    • Cytochrome b-c1 complex subunit 1 antibody
    • cytochrome b-c1 complex subunit 1, mitochondrial antibody
    • D3S3191 antibody
    • mitochondrial antibody
    • OTTHUMP00000164820 antibody
    • QCR1 antibody
    • QCR1_HUMAN antibody
    • Ubiquinol cytochrome c reductase complex core protein 1 antibody
    • ubiquinol-cytochrome c reductase core protein I antibody
    • Ubiquinol-cytochrome-c reductase complex core protein 1 antibody
    • UQCR1 antibody
    • Uqcrc1 antibody
    see all

Images

  • Paraffin-embedded human heart muscle tissue stained for UQCRC1 using ab223746 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lymph node tissue stained for UQCRC1 using ab223746 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for UQCRC1 using ab223746 at 1/200 dilution in immunohistochemical analysis.

  • Anti-UQCRC1 antibody (ab223746) at 1/100 dilution + HEK-293 (human epithelial cell line from embryonic kidney) cell lysate

    Predicted band size: 53 kDa

  • All lanes : Anti-UQCRC1 antibody (ab223746) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate
    Lane 3 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell lysate

    Predicted band size: 53 kDa

References

ab223746 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up