Anti-Uridine Phosphorylase 1 antibody (ab185680)
Key features and details
- Rabbit polyclonal to Uridine Phosphorylase 1
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Uridine Phosphorylase 1 antibody
See all Uridine Phosphorylase 1 primary antibodies -
Description
Rabbit polyclonal to Uridine Phosphorylase 1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Uridine Phosphorylase 1 aa 4-47 (N terminal).
Sequence:TGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFP
Database link: Q16831 -
Positive control
- IHC-P: Human esophagus tissue. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab185680 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Function
Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. -
Pathway
Pyrimidine metabolism; UMP biosynthesis via salvage pathway; uracil from uridine (phosphorylase route): step 1/1. -
Sequence similarities
Belongs to the PNP/UDP phosphorylase family. - Information by UniProt
-
Database links
- Entrez Gene: 7378 Human
- Omim: 191730 Human
- SwissProt: Q16831 Human
- Unigene: 488240 Human
-
Alternative names
- UDRPASE antibody
- UP antibody
- UPase 1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Uridine Phosphorylase 1 antibody (ab185680)
Paraffin embedded human esophagus tissue stained for Uridine Phosphorylase 1 using ab185680 at 1/200 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
-
U-2 OS cells stained for Uridine Phosphorylase 1 (green) using ab185680 at 2 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Uridine Phosphorylase 1 antibody (ab185680)
Paraffin embedded human stomach tissue stained for Uridine Phosphorylase 1 using ab185680 at 1/200 dilution in immunohistochemical analysis. Shows low expression as expected.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
Datasheets and documents
References (0)
ab185680 has not yet been referenced specifically in any publications.