Overview

  • Product name

  • Description

    Rabbit polyclonal to Urm1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Goat, Chicken, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Urm1 aa 6-100.
    Sequence:

    SVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPE LFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHG


    Database link: Q9BTM9

  • Positive control

    • ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. May also act as an ubiquitin-like protein that is covalently conjugated to other proteins; the relevance of such function is however unclear in vivo.
  • Pathway

    tRNA modification; 5-methoxycarbonylmethyl-2-thiouridine-tRNA biosynthesis.
  • Sequence similarities

    Belongs to the URM1 family.
  • Post-translational
    modifications

    C-terminal thiocarboxylation occurs in 2 steps, it is first acyl-adenylated (-COAMP) via the hesA/moeB/thiF part of MOCS3, then thiocarboxylated (-COSH) via the rhodanese domain of MOCS3.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2900073H19Rik antibody
    • C9orf74 antibody
    • Chromosome 9 open reading frame 74 antibody
    • MGC2668 antibody
    • RGD1306599 antibody
    • RP11 339B21.4 antibody
    • RP23-443G7.1 antibody
    • Ubiquitin related modifier 1 antibody
    • Ubiquitin related modifier 1 homolog antibody
    • Ubiquitin-related modifier 1 homolog antibody
    • Urm 1 antibody
    • URM1 antibody
    • URM1_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of MCF7 cells (PFA-fixed/Triton X-100 permeabilized) labeling Urm1 with ab220490 at 4 μg/mL (green).

References

ab220490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up