Overview

  • Product name

  • Description

    Rabbit polyclonal to Urocortin 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Urocortin 3 aa 24-78.
    Sequence:

    HKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSGEEE EGKEK


    Database link: Q969E3

  • Positive control

    • IHC-P: Human duodenum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Urocortin 3 is a member of the sauvagine/corticotropin-releasing factor/urotensin I family. It is structurally related to the corticotropin-releasing factor (CRF) gene and the encoded product is an endogenous ligand for CRF type 2 receptors. In the brain it may be responsible for the effects of stress on appetite. In spite of the gene family name similarity, the product of this gene has no sequence similarity to urotensin II. A powerful cytoprotective effect of urocortin peptide administration against ischemia and reperfusion injury has been demonstrated in isolated cardiomyocyte models, as well as in the intact heart both in vitro and in vivo.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • MGC119002 antibody
    • OTTHUMP00000018999 antibody
    • Prepro urocortin 3 antibody
    • SCP antibody
    • SPC antibody
    • Stresscopin antibody
    • Ucn III antibody
    • UCN3 antibody
    • UCN3 urocortin 3 stresscopin antibody
    • UCNIII antibody
    • Urocortin 3 antibody
    • Urocortin 3 stresscopin antibody
    • Urocortin III antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for Urocortin 3 using ab224545 at 1/200 dilution in immunohistochemical analysis

References

ab224545 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224545.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up