Overview

  • Product name

    Urocortin II (mouse), CRFR2beta agonist
  • Description

    Selective CRFR2β agonist
  • Biological description

    Selective CRFR2β agonist. Urocontin (Asc 2962) homolog. Induces ERK1/2 phosphorylation and cAMP stimulation. Shows central autonomic, appetitive control and cardioprotective effects in vivo.
  • Purity

    > 95%
  • CAS Number

    330648-32-3
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    4152.91
  • Molecular formula

    C187H320N56O50
  • Sequence

    VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV (Modifications: C-terminal amide)
  • Storage instructions

    Store at +4°C. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

  • Research areas

References

This product has been referenced in:

  • Vaughan JM  et al. Posttranslational processing of human and mouse urocortin 2: characterization and bioactivity of gene products. Endocrinology 154:1553-64 (2013). Read more (PubMed: 23493376) »
  • Brar BK  et al. Urocortin-II and urocortin-III are cardioprotective against ischemia reperfusion injury: an essential endogenous cardioprotective role for corticotropin releasing factor receptor type 2 in the murine heart. Endocrinology 145:24-35; discussion 21-3 (2004). Read more (PubMed: 12970163) »
  • Martínez V  et al. Differential actions of peripheral corticotropin-releasing factor (CRF), urocortin II, and urocortin III on gastric emptying and colonic transit in mice: role of CRF receptor subtypes 1 and 2. J Pharmacol Exp Ther 301:611-7 (2002). Read more (PubMed: 11961064) »
  • Reyes TM  et al. Urocortin II: a member of the corticotropin-releasing factor (CRF) neuropeptide family that is selectively bound by type 2 CRF receptors. Proc Natl Acad Sci U S A 98:2843-8 (2001). Read more (PubMed: 11226328) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab142964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up