Overview

  • Product name

    Urocortin III (human), CRF2 receptor agonist
  • Description

    Potent, selective CRF2 receptor agonist
  • Purity

    > 95%
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    4137.96
  • Molecular formula

    C185H307N53O50S2
  • Sequence

    FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI (Modifications: C-terminal amide)
  • PubChem identifier

    56843277
  • Storage instructions

    Store at +4°C. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

  • Research areas

References

This product has been referenced in:

  • Brar BK  et al. Urocortin-II and urocortin-III are cardioprotective against ischemia reperfusion injury: an essential endogenous cardioprotective role for corticotropin releasing factor receptor type 2 in the murine heart. Endocrinology 145:24-35; discussion 21-3 (2004). Read more (PubMed: 12970163) »
  • Martínez V  et al. Differential actions of peripheral corticotropin-releasing factor (CRF), urocortin II, and urocortin III on gastric emptying and colonic transit in mice: role of CRF receptor subtypes 1 and 2. J Pharmacol Exp Ther 301:611-7 (2002). Read more (PubMed: 11961064) »
  • Lewis K  et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Proc Natl Acad Sci U S A 98:7570-5 (2001). Read more (PubMed: 11416224) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab142965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up