Overview

  • Product name

    Anti-Uroguanylin antibody
  • Description

    Mouse polyclonal to Uroguanylin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Uroguanylin aa 1-112.
    Sequence:

    MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQ WAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDC ELCVNVACTGCL


    Database link: NP_009033.1

  • Positive control

    • Uroguanylin transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab171982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 12.32 kDa.

Target

  • Function

    Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
  • Tissue specificity

    Stomach and intestine.
  • Sequence similarities

    Belongs to the guanylin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • GCAP II antibody
    • GCAP-II antibody
    • Guanylate cyclase activator 2B antibody
    • Guanylate cyclase C-activating peptide II antibody
    • GUC2B_HUMAN antibody
    • GUCA2B antibody
    • UGN antibody
    • Uroguanylin antibody
    see all

Images

  • All lanes : Anti-Uroguanylin antibody (ab171982) at 1 µg/ml

    Lane 1 : Uroguanylin transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Secondary
    All lanes : Goat Anti-Mouse IgG at 1/2500 dilution

    Predicted band size: 12.32 kDa

References

ab171982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up