Overview

  • Product name

    Anti-Uroplakin III antibody
    See all Uroplakin III primary antibodies
  • Description

    Rabbit polyclonal to Uroplakin III
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Uroplakin III aa 15-212. Expressed in E.coli.
    Sequence:

    CGWTVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGAYEVYLY AMVDSAISWNVSVQDSTGAPLSTTFRQTQGGRSGPYKAVAFDLTPCGDLP SLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRF KYVLVNTSTGLVQDQTLWSDPIRTNRPSPYLAIDTWPGRRSGGMIVIT


    Database link: D3ZZ76

  • Positive control

    • WB: Recombinant rat Uroplakin III protein; Mouse and rat bladder lysates; Human serum. IHC-P: Rat kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231576 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 31 kDa.

Target

  • Function

    Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence.
  • Tissue specificity

    Expressed in ureter.
  • Involvement in disease

    Defects in UPK3A are a cause of renal adysplasia (RADYS) [MIM:191830]; also known as renal agenesis or renal aplasia. Renal agenesis refers to the absence of one (unilateral) or both (bilateral) kidneys at birth. Bilateral renal agenesis belongs to a group of perinatally lethal renal diseases, including severe bilateral renal dysplasia, unilateral renal agenesis with contralateral dysplasia and severe obstructive uropathy.
  • Sequence similarities

    Belongs to the uroplakin-3 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Heterodimer formation with UPK1B is a prerequisite to exit out of the endoplasmic reticulum (ER).
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC119178 antibody
    • OTTHUMP00000028951 antibody
    • UP III antibody
    • UP3a antibody
    • UPIII antibody
    • UPIIIA antibody
    • UPK 3 antibody
    • UPK 3A antibody
    • UPK3 antibody
    • UPK3A antibody
    • UPK3A_HUMAN antibody
    • Uroplakin 3A antibody
    • Uroplakin III antibody
    • Uroplakin-3a antibody
    • Uroplakin3A antibody
    • UroplakinIII antibody
    see all

Images

  • Anti-Uroplakin III antibody (ab231576) at 2 µg/ml + Recombinant rat Uroplakin III protein

    Predicted band size: 31 kDa

  • Anti-Uroplakin III antibody (ab231576) at 1 µg/ml + Rat bladder lysate

    Predicted band size: 31 kDa

  • Anti-Uroplakin III antibody (ab231576) at 2 µg/ml + Mouse bladder lysate

    Predicted band size: 31 kDa

  • Anti-Uroplakin III antibody (ab231576) at 1 µg/ml + Human serum

    Predicted band size: 31 kDa

  • All lanes : Anti-Uroplakin III antibody (ab231576) at 1 µg/ml

    Lane 1 : Rat bladder lysate
    Lane 2 : Mouse bladder lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 31 kDa

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for Uroplakin III using ab231576 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up