Overview

  • Product name

    Anti-Uroplakin II/UPII antibody
    See all Uroplakin II/UPII primary antibodies
  • Description

    Rabbit polyclonal to Uroplakin II/UPII
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Uroplakin II/UPII aa 88-149.
    Sequence:

    SVVDSGAGFTVTRLSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMST LPRRNMESIGLG


    Database link: O00526

  • Positive control

    • Human urinary bladder tissue.
  • General notes

    Previously labelled as Uroplakin II. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.
  • Cellular localization

    Cell membrane
  • Database links

  • Alternative names

    • MGC138598 antibody
    • UP2 antibody
    • UPII antibody
    • UPK2 antibody
    • Uroplakin 2 antibody
    • Uroplakin II antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human urinary bladder tissue labeling Uroplakin II/UPII with ab204756 at 1/1000 dilution.

  • Immunohistochemical analysis of paraffin-embedded human endometrium tissue labeling Uroplakin II/UPII with ab204756 at 1/1000 dilution.

  • Immunohistochemical analysis of paraffin-embedded human liver tissue labeling Uroplakin II/UPII with ab204756 at 1/1000 dilution.

  • Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labeling Uroplakin II/UPII with ab204756 at 1/1000 dilution.

References

ab204756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up