Anti-USH1C/Harmonin antibody (ab244404)
Key features and details
- Rabbit polyclonal to USH1C/Harmonin
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-USH1C/Harmonin antibody
See all USH1C/Harmonin primary antibodies -
Description
Rabbit polyclonal to USH1C/Harmonin -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human USH1C/Harmonin aa 363-442.
Sequence:IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPEL EPADDLDGGTEEQGEQDFRKYEEGFDPYSM
Database link: Q9Y6N9 -
Positive control
- ICC/IF: Caco-2 cells. WB: Caco-2 and NIH/3T3 cell lysate. IHC-P: Human duodenum tissue.
-
General notes
This product was previously labelled as USH1C
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244404 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May be involved in protein-protein interaction. -
Tissue specificity
Expressed in small intestine, colon, kidney, eye and weakly in pancreas. Expressed also in vestibule of the inner ear. -
Involvement in disease
Defects in USH1C are the cause of Usher syndrome type 1C (USH1C) [MIM:276904]; also known as Usher syndrome type I Acadian variety. USH is a genetically heterogeneous condition characterized by the association of retinitis pigmentosa and sensorineural deafness. Age at onset and differences in auditory and vestibular function distinguish Usher syndrome type 1 (USH1), Usher syndrome type 2 (USH2) and Usher syndrome type 3 (USH3). USH1 is characterized by profound congenital sensorineural deafness, absent vestibular function and prepubertal onset of progressive retinitis pigmentosa leading to blindness.
Defects in USH1C are the cause of deafness autosomal recessive type 18 (DFNB18) [MIM:602092]. DFNB18 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. -
Sequence similarities
Contains 3 PDZ (DHR) domains. -
Domain
The PDZ domain 1 mediates interactions with USH1G/SANS and SLC4A7. - Information by UniProt
-
Database links
- Entrez Gene: 10083 Human
- Entrez Gene: 72088 Mouse
- Omim: 605242 Human
- SwissProt: Q9Y6N9 Human
- SwissProt: Q9ES64 Mouse
- Unigene: 502072 Human
- Unigene: 119709 Mouse
-
Alternative names
- AIE 75 antibody
- AIE75 antibody
- Antigen NY CO 38/NY CO 37 antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized Caco-2 (human colorectal adenocarcinoma cell line) cells stained for USH1C/Harmonin (green) using ab244404 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-USH1C/Harmonin antibody (ab244404)
Paraffin-embedded human duodenum tissue stained for USH1C/Harmonin using ab244404 at 1/50 dilution in immunohistochemical analysis.
-
All lanes : Anti-USH1C/Harmonin antibody (ab244404) at 0.4 µg/ml
Lane 1 : Caco-2 (Human colorectal adenocarcinoma cell line) cell lysate
Lane 2 : PC-3 (Human prostate adenocarcinoma cell line) cell lysate -
All lanes : Anti-USH1C/Harmonin antibody (ab244404) at 0.4 µg/ml
Lane 1 : NIH/3T3 (Mouse embryo fibroblast cell line) cell lysate
Lane 2 : NBT-II (Rat cell line) cell lysate
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244404 has not yet been referenced specifically in any publications.