For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    ush1charmonin-antibody-ab244404.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Sensory System Visual system
Share by email

Anti-USH1C/Harmonin antibody (ab244404)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-USH1C/Harmonin antibody (ab244404)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-USH1C/Harmonin antibody (ab244404)
  • Western blot - Anti-USH1C/Harmonin antibody (ab244404)
  • Western blot - Anti-USH1C/Harmonin antibody (ab244404)

Key features and details

  • Rabbit polyclonal to USH1C/Harmonin
  • Suitable for: WB, ICC/IF, IHC-P
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Protein
Product image
Recombinant Human USH1C/Harmonin protein (Tagged) (ab239541)

View more associated products

Overview

  • Product name

    Anti-USH1C/Harmonin antibody
    See all USH1C/Harmonin primary antibodies
  • Description

    Rabbit polyclonal to USH1C/Harmonin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human USH1C/Harmonin aa 363-442.
    Sequence:

    IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPEL EPADDLDGGTEEQGEQDFRKYEEGFDPYSM


    Database link: Q9Y6N9
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • ICC/IF: Caco-2 cells. WB: Caco-2 and NIH/3T3 cell lysate. IHC-P: Human duodenum tissue.
  • General notes

     This product was previously labelled as USH1C

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Sensory System
    • Visual system
    • Neuroscience
    • Sensory System
    • Auditory system

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Positive Controls

    • NIH 3T3 whole cell lysate (ab7179)
  • Recombinant Protein

    • Recombinant Human USH1C/Harmonin protein (Tagged) (ab239541)
  • Related Products

    • Recombinant Human USH1C/Harmonin protein (Tagged) (ab239541)

Applications

Our Abpromise guarantee covers the use of ab244404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.04 - 0.4 µg/ml.
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be involved in protein-protein interaction.
  • Tissue specificity

    Expressed in small intestine, colon, kidney, eye and weakly in pancreas. Expressed also in vestibule of the inner ear.
  • Involvement in disease

    Defects in USH1C are the cause of Usher syndrome type 1C (USH1C) [MIM:276904]; also known as Usher syndrome type I Acadian variety. USH is a genetically heterogeneous condition characterized by the association of retinitis pigmentosa and sensorineural deafness. Age at onset and differences in auditory and vestibular function distinguish Usher syndrome type 1 (USH1), Usher syndrome type 2 (USH2) and Usher syndrome type 3 (USH3). USH1 is characterized by profound congenital sensorineural deafness, absent vestibular function and prepubertal onset of progressive retinitis pigmentosa leading to blindness.
    Defects in USH1C are the cause of deafness autosomal recessive type 18 (DFNB18) [MIM:602092]. DFNB18 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities

    Contains 3 PDZ (DHR) domains.
  • Domain

    The PDZ domain 1 mediates interactions with USH1G/SANS and SLC4A7.
  • Target information above from: UniProt accession Q9Y6N9 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 10083 Human
    • Entrez Gene: 72088 Mouse
    • Omim: 605242 Human
    • SwissProt: Q9Y6N9 Human
    • SwissProt: Q9ES64 Mouse
    • Unigene: 502072 Human
    • Unigene: 119709 Mouse
    • Alternative names

      • AIE 75 antibody
      • AIE75 antibody
      • Antigen NY CO 38/NY CO 37 antibody
      • Antigen NY-CO-38/NY-CO-37 antibody
      • Autoimmune enteropathy related antigen AIE 75 antibody
      • Autoimmune enteropathy related antigen AIE75 antibody
      • Autoimmune enteropathy-related antigen AIE-75 antibody
      • Deafness autosomal recessive 18 antibody
      • DFNB 18 antibody
      • DFNB18 antibody
      • Harmonin antibody
      • NY CO 37 antibody
      • NY CO 38 antibody
      • PDZ 45 antibody
      • PDZ 73 antibody
      • PDZ 73 protein antibody
      • PDZ 73/NY CO 38 antibody
      • PDZ45 antibody
      • PDZ73 antibody
      • PDZ73 protein antibody
      • Protein PDZ-73 antibody
      • Renal carcinoma antigen NY REN 3 antibody
      • Renal carcinoma antigen NY-REN-3 antibody
      • USH 1C antibody
      • USH1C antibody
      • USH1C_HUMAN antibody
      • Ush1cpst antibody
      • Usher syndrome 1C (autosomal recessive severe) antibody
      • Usher syndrome 1C antibody
      • Usher syndrome type 1C protein antibody
      • Usher syndrome type-1C protein antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-USH1C/Harmonin antibody (ab244404)
      Immunocytochemistry/ Immunofluorescence - Anti-USH1C/Harmonin antibody (ab244404)

      PFA-fixed, Triton X-100 permeabilized Caco-2 (human colorectal adenocarcinoma cell line) cells stained for USH1C/Harmonin (green) using ab244404 at 4 µg/ml in ICC/IF.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-USH1C/Harmonin antibody (ab244404)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-USH1C/Harmonin antibody (ab244404)

      Paraffin-embedded human duodenum tissue stained for USH1C/Harmonin using ab244404 at 1/50 dilution in immunohistochemical analysis.

    • Western blot - Anti-USH1C/Harmonin antibody (ab244404)
      Western blot - Anti-USH1C/Harmonin antibody (ab244404)
      All lanes : Anti-USH1C/Harmonin antibody (ab244404) at 0.4 µg/ml

      Lane 1 : Caco-2 (Human colorectal adenocarcinoma cell line) cell lysate
      Lane 2 : PC-3 (Human prostate adenocarcinoma cell line) cell lysate
    • Western blot - Anti-USH1C/Harmonin antibody (ab244404)
      Western blot - Anti-USH1C/Harmonin antibody (ab244404)
      All lanes : Anti-USH1C/Harmonin antibody (ab244404) at 0.4 µg/ml

      Lane 1 : NIH/3T3 (Mouse embryo fibroblast cell line) cell lysate
      Lane 2 : NBT-II (Rat cell line) cell lysate

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab244404? Please let us know so that we can cite the reference in this datasheet.

    ab244404 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab244404.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.