Overview

  • Product name

  • Description

    Rabbit polyclonal to USP14/TGT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rabbit, Cow, Chimpanzee
  • Immunogen

    Recombinant full length protein corresponding to Human USP14/TGT aa 1-494.
    Sequence:

    MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKG GTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASA MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQ YITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDA NECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVE FETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITK QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFP LMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVK YEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKF DDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ


    Database link: P54578-1

  • Positive control

    • WB: HeLa, HEK-293T and NIH/3T3 whole cell lysates. IHC-P: Human prostate cancer and kidney tissues. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as USP14

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 56 kDa.

Target

  • Function

    Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Indispensable for synaptic development and function at neuromuscular junctions (NMJs).
  • Sequence similarities

    Belongs to the peptidase C19 family. USP14/UBP6 subfamily.
    Contains 1 ubiquitin-like domain.
  • Cellular localization

    Cytoplasm. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Deubiquitinating enzyme 14 antibody
    • TGT antibody
    • tRNA guanine transglycosylase 60 kD subunit antibody
    • tRNA guanine transglycosylase antibody
    • Ubiquitin carboxyl terminal hydrolase 14 antibody
    • Ubiquitin carboxyl-terminal hydrolase 14 antibody
    • Ubiquitin specific peptidase 14 antibody
    • Ubiquitin specific processing protease 14 antibody
    • Ubiquitin specific protease 14 antibody
    • Ubiquitin thiolesterase 14 antibody
    • Ubiquitin-specific-processing protease 14 antibody
    • UBP14_HUMAN antibody
    • USP 14 antibody
    • USP14 antibody
    see all

Images

  • All lanes : Anti-USP14/TGT antibody (ab235960) at 1/500 dilution

    Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 3 : NIH/3T3 (Mouse embryo fibroblast cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 56 kDa

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for USP14/TGT using ab235960 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human kidney tissue stained for USP14/TGT with ab235960 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for USP14/TGT with ab235960 at 1/100 dilution in immunohistochemical analysis.

References

ab235960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up