Anti-USP24 antibody (ab221640)
Key features and details
- Rabbit polyclonal to USP24
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-USP24 antibody
See all USP24 primary antibodies -
Description
Rabbit polyclonal to USP24 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human USP24 aa 1220-1325.
Sequence:RDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTLLDEDLTKDGIEALS SRPFRNVSRQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAI QTMEVS
Database link: Q9UPU5 -
Positive control
- ICC/IF: U-251 MG cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab221640 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Involved in the ubiquitin-dependent proteolytic pathway in conjunction with the 26S proteasome. -
Sequence similarities
Belongs to the peptidase C19 family.
Contains 1 UBA domain. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. - Information by UniProt
-
Database links
- Entrez Gene: 23358 Human
- Entrez Gene: 329908 Mouse
- Omim: 610569 Human
- SwissProt: Q9UPU5 Human
- SwissProt: B1AY13 Mouse
- Unigene: 477009 Human
- Unigene: 234544 Mouse
-
Alternative names
- Deubiquitinating enzyme 24 antibody
- KIAA1057 antibody
- Ubiquitin carboxyl terminal hydrolase 24 antibody
see all
Images
Protocols
Datasheets and documents
References (0)
ab221640 has not yet been referenced specifically in any publications.